KEGG   Homo sapiens (human): 9833Help
Entry
9833              CDS       T01001                                 

Gene name
MELK, HPK38
Definition
(RefSeq) maternal embryonic leucine zipper kinase (EC:2.7.11.1 2.7.10.2)
  KO
K08799  
maternal embryonic leucine zipper kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9833 (MELK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   9833 (MELK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13.2
AA seq 651 aa AA seqDB search
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEA
LKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAV
AYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI
QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL
QQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQT
MEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDV
TASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPI
KIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITV
LTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQT
QSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattatgatgaacttctcaaatattatgaattacatgaaactattgggacaggt
ggctttgcaaaggtcaaacttgcctgccatatccttactggagagatggtagctataaaa
atcatggataaaaacacactagggagtgatttgccccggatcaaaacggagattgaggcc
ttgaagaacctgagacatcagcatatatgtcaactctaccatgtgctagagacagccaac
aaaatattcatggttcttgagtactgccctggaggagagctgtttgactatataatttcc
caggatcgcctgtcagaagaggagacccgggttgtcttccgtcagatagtatctgctgtt
gcttatgtgcacagccagggctatgctcacagggacctcaagccagaaaatttgctgttt
gatgaatatcataaattaaagctgattgactttggtctctgtgcaaaacccaagggtaac
aaggattaccatctacagacatgctgtgggagtctggcttatgcagcacctgagttaata
caaggcaaatcatatcttggatcagaggcagatgtttggagcatgggcatactgttatat
gttcttatgtgtggatttctaccatttgatgatgataatgtaatggctttatacaagaag
attatgagaggaaaatatgatgttcccaagtggctctctcccagtagcattctgcttctt
caacaaatgctgcaggtggacccaaagaaacggatttctatgaaaaatctattgaaccat
ccctggatcatgcaagattacaactatcctgttgagtggcaaagcaagaatccttttatt
cacctcgatgatgattgcgtaacagaactttctgtacatcacagaaacaacaggcaaaca
atggaggatttaatttcactgtggcagtatgatcacctcacggctacctatcttctgctt
ctagccaagaaggctcggggaaaaccagttcgtttaaggctttcttctttctcctgtgga
caagccagtgctaccccattcacagacatcaagtcaaataattggagtctggaagatgtg
accgcaagtgataaaaattatgtggcgggattaatagactatgattggtgtgaagatgat
ttatcaacaggtgctgctactccccgaacatcacagtttaccaagtactggacagaatca
aatggggtggaatctaaatcattaactccagccttatgcagaacacctgcaaataaatta
aagaacaaagaaaatgtatatactcctaagtctgctgtaaagaatgaagagtactttatg
tttcctgagccaaagactccagttaataagaaccagcataagagagaaatactcactacg
ccaaatcgttacactacaccctcaaaagctagaaaccagtgcctgaaagaaactccaatt
aaaataccagtaaattcaacaggaacagacaagttaatgacaggtgtcattagccctgag
aggcggtgccgctcagtggaattggatctcaaccaagcacatatggaggagactccaaaa
agaaagggagccaaagtgtttgggagccttgaaagggggttggataaggttatcactgtg
ctcaccaggagcaaaaggaagggttctgccagagacgggcccagaagactaaagcttcac
tataacgtgactacaactagattagtgaatccagatcaactgttgaatgaaataatgtct
attcttccaaagaagcatgttgactttgtacaaaagggttatacactgaagtgtcaaaca
cagtcagattttgggaaagtgacaatgcaatttgaattagaagtgtgccagcttcaaaaa
cccgatgtggtgggtatcaggaggcagcggcttaagggcgatgcctgggtttacaaaaga
ttagtggaagacatcctatctagctgcaaggtataa

DBGET integrated database retrieval system