KEGG   Homo sapiens (human): 984Help
Entry
984               CDS       T01001                                 

Gene name
CDK11B, CDC2L1, CDK11, CDK11-p110, CDK11-p46, CDK11-p58, CLK-1, PITSLREA, PK58, p58, p58CDC2L1, p58CLK-1
Definition
(RefSeq) cyclin-dependent kinase 11B (EC:2.7.11.22)
  KO
K08818  
cell division cycle 2-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     984 (CDK11B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   984 (CDK11B)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    984 (CDK11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33
AA seq 565 aa AA seqDB search
MREDYSDKVKASHWSRSPPRPPRERFELGDGRKPVKEEKMEERDLLSDLQDISDSERKTS
SAESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAE
EVSEEEMSEDEERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDS
PALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLK
MEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETM
KQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSP
LKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKV
FKDLGTPSEKIWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGR
RISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL
KETGFHLTTTNQGASAAGPGFSLKF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggactacagcgacaaagtgaaagccagccactggagtcgcagcccgcctcgg
ccgccgcgggagcggttcgagttgggagacggccggaagccagtaaaagaagagaaaatg
gaagaaagggacctgctgtccgacttacaggacatcagcgacagcgagaggaagaccagc
tcggccgagtcctcgtcagcggaatcaggctcaggttctgaggaagaagaggaggaggag
gaagaggaggaggaggaagggagcaccagtgaagaatcagaggaggaggaggaggaagag
gaagaggaggaggaggagaccggcagcaactctgaggaggcatcagagcagtctgccgaa
gaagtaagtgaggaagaaatgagtgaagatgaagaacgagaaaatgaaaaccacctcttg
gttgttccagagtcacggttcgaccgagattccggggagagtgaagaagcagaggaagaa
gtgggtgagggaacgccgcagagcagcgccctgacagagggcgactatgtgcccgactcc
cctgccctgtcgcccatcgagctcaagcaggagctgcccaagtacctgccggccctgcag
ggctgccggagcgtcgaggagttccagtgcctgaacaggatcgaggagggcacctatgga
gtggtctacagagcaaaagacaagaaaacagatgaaattgtggctctaaagcggctgaag
atggagaaggagaaggagggcttcccgatcacgtcgctgagggagatcaacaccatcctc
aaggcccagcatcccaacatcgtcaccgttagagagattgtggtgggcagcaacatggac
aagatctacatcgtgatgaactatgtggagcacgacctcaagagcctgatggagaccatg
aaacagcccttcctgccaggggaggtgaagaccctgatgatccagctgctgcgtggggtg
aaacacctgcacgacaactggatcctgcaccgtgacctcaagacgtccaacctgctgctg
agccacgccggcatcctcaaggtgggtgacttcgggctggcgcgggagtacggatcccct
ctgaaggcctacaccccggtcgtggtgaccctgtggtaccgcgccccagagctgctgctt
ggtgccaaggaatactccacggccgtggacatgtggtcagtgggttgcatcttcggggag
ctgctgactcagaagcctctgttccccgggaagtcagaaatcgatcagatcaacaaggtg
ttcaaggatctggggacccctagtgagaaaatctggcccggctacagcgagctcccagca
gtcaagaagatgaccttcagcgagcacccctacaacaacctccgcaagcgcttcggggct
ctgctctcagaccagggcttcgacctcatgaacaagttcctgacctacttccccgggagg
aggatcagcgctgaggacggcctcaagcatgagtatttccgcgagacccccctccccatc
gacccctccatgttccccacgtggcccgccaagagcgagcagcagcgtgtgaagcggggc
accagcccgaggccccctgagggaggcctgggctacagccagctgggtgacgacgacctg
aaggagacgggcttccaccttaccaccacgaaccagggggcctctgccgcgggccccggc
ttcagcctcaagttctga

DBGET integrated database retrieval system