KEGG   Homo sapiens (human): 9846Help
Entry
9846              CDS       T01001                                 

Gene name
GAB2
Definition
(RefSeq) GRB2 associated binding protein 2
  KO
K08091  
growth factor receptor bound protein 2-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Osteoclast differentiation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    9846 (GAB2)
   04072 Phospholipase D signaling pathway
    9846 (GAB2)
   04071 Sphingolipid signaling pathway
    9846 (GAB2)
 Organismal Systems
  Immune system
   04664 Fc epsilon RI signaling pathway
    9846 (GAB2)
   04666 Fc gamma R-mediated phagocytosis
    9846 (GAB2)
  Development
   04380 Osteoclast differentiation
    9846 (GAB2)
 Human Diseases
  Cancers
   05220 Chronic myeloid leukemia
    9846 (GAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UQC2(Tbio)
UniProt: 
Position
11q14.1
AA seq 676 aa AA seqDB search
MSGGGDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNDHSKKPLRI
INLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEEDMNKWVQSICQICGFNQ
AEESTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHM
QPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNG
ISGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTPSN
TLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQ
AETPRWGSPQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPQRGGESAG
RSAESMSDGVGSFLPGKMIVGRSDSTNSEDNYVPMNPGSSTLLAMERAGDNSQSVYIPMS
PGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELP
FKSPITKSWSRANHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGT
NSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQE
WTDVRQSSEPSKGAKL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcggcgacgtggtgtgcaccggctggctgaggaaatcgcctcccgagaag
aagttgaggcgctatgcctggaagaaacgctggtttatcctgcggagtggccggatgagc
ggtgacccagatgttctggaatactacaagaacgatcactccaagaagcctctgcggatc
atcaacctgaacttctgtgagcaggtagatgcaggcctgacctttaacaagaaggagctg
caggatagttttgtgtttgacatcaagaccagtgaacgcaccttttacctggtggctgag
acagaagaggacatgaataagtgggtccagagcatctgccagatctgtggcttcaatcag
gctgaggagagcacagactccctgagaaatgtttcctcagccggtcatggcccccgctct
tctccagctgagctcagcagctctagccagcaccttctccgagagcgcaagtcctcagcc
ccatcacactccagccagccaactctgttcacgtttgaaccccctgtgtcaaaccacatg
cagcccaccttgtccaccagcgcacctcaggagtatctctacttgcaccagtgcataagc
cgaagagcagaaaatgcaaggagtgccagcttctctcagggcaccagagcctcttttctc
atgaggagtgacacagctgtacaaaaacttgcccagggcaatggacactgtgtcaacggg
atcagtggtcaagtccatggcttctatagccttcccaagccgagccggcacaatacagaa
ttcagagacagtacctacgacctcccccgcagcctggcctcccatggccacaccaagggc
agcctcacaggctccgagacagataatgaggatgtgtacaccttcaagacgcccagcaac
accctgtgcagggagttcggggacctcctggtagacaatatggatgttccggccacccca
ctctcagcctaccagatccctaggacattcactctggacaaaaaccacaatgccatgaca
gtggccactcctggggactcagccatagctcccccaccccgcccccccaagccaagtcag
gcagaaacacctcgatggggcagtcctcagcagagaccgccaatcagtgaaaatagcaga
tctgtcgctgccaccatccccagacgcaacaccctccctgcaatggacaacagccgactt
caccgagcttcttcctgtgagacctacgagtacccacagcgtggtggagagagtgcaggc
cggtctgctgaatccatgagtgatggagttggctctttcctgccagggaaaatgattgtg
ggccgatcggacagcaccaattctgaagacaactatgtgcccatgaatccaggttcttcc
accctgttggccatggaacgagcaggtgataattcccagagcgtctacatcccaatgagc
ccaggggcccatcactttgactcacttggctacccatcaacaacccttcctgtgcaccga
ggccccagcagaggaagtgagattcagccaccccctgtcaaccgcaacctcaaacctgat
cggaaagcaaagccaacaccacttgacctgaggaacaacaccgtcatcgatgaactcccc
ttcaagtcacctatcaccaagtcttggtctagggccaaccacaccttcaactccagctcc
tcccagtactgccgccccatctccacccagagcatcaccagcacagactcaggagacagc
gaagagaactatgtccctatgcaaaacccagtgtctgcatctcccgttcccagtggcacg
aacagtcctgcccctaagaagagcaccggcagcgttgattatctggccctggacttccag
ccgagctccccaagcccccaccgcaagccatctacttcatccgtcacctctgatgagaag
gtggactacgttcaggtggacaaggagaagacccaggccctgcagaacaccatgcaggag
tggacagacgtgcggcagtcctcagagccttccaagggtgccaagctgtga

DBGET integrated database retrieval system