KEGG   Homo sapiens (human): 9855Help
Entry
9855              CDS       T01001                                 

Gene name
FARP2, FIR, FRG, PLEKHC3
Definition
FERM, RhoGEF and pleckstrin domain protein 2
Orthology
K06082  
FERM, RhoGEF and pleckstrin domain protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9855 (FARP2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    9855 (FARP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 647 aa AA seqDB search
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKVFQLHEGHVAGVTKME
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgggggagatagaaggaacatacagagtcctgcagactgcagggatgcgcttgggtgcc
cagacccctgtgggagttagcacccttgagcctgggcagactctcttgcccagaatgcaa
gagaagcacctgcacctcagagtaaagctgctggacaacaccatggaaatatttgacatt
gagcctaaatgcgatggccaggtattactgacacaagtgtggaagcgtttaaacctggta
gaatgtgactacttcgggatggagtttcaaaatactcagtcctactggatttggcttgaa
cctatgaaacccatcattaggcaaatacgaaggccaaagaatgtggtgcttcgcctagct
gtaaaattttttccacctgatcctggtcagctacaagaagaatatacaagatacttgttt
gccttgcaacttaagagagacctgctggaagagcgtttgacctgtgctgacaccacagcg
gcccttctcacgtcccatctcctgcagtcggaaataggagattacgatgaaacgctggac
cgagagcacctcaaagtgaacgagtatttgcctggccagcagcactgccttgagaagata
ctagaattccatcagaagcacgtgggccagacacctgctgagtcggatttccaggtgctc
gaaattgctcgaaagttggaaatgtacggcatcagatttcacatggcttctgacagggaa
ggaaccaagattcaactggcagtttcccacatgggtgtactcgtgttccagggcaccacc
aaaatcaacactttcaactggtccaaggtccgtaaactaagcttcaagaggaaaagattt
cttatcaaacttcatccagaggttcatggaccttaccaggacacattagaatttttgttg
ggtagtagagatgaatgtaagaacttctggaagatttgtgtggagtatcacacctttttt
agacttttggaccaacctaagccaaaagcaaaagccgtcttcttcagccggggctcctcc
ttcagatacagtggaagaactcagaaacaactagtagattatttcaaagacagtggaatg
aagagaattccatatgaaagaaggcacagcaagacccacacgtccgttcgagctctgact
gcagacctaccaaaacagagcatctcattccccgagggattgaggactcctgcctcccca
tcttcagcgaatgccttttactcgctctctccctccactctggtcccctctggcctgcca
gagtttaaggacagcagcagctccctcacagatccccaggtttcctacgtcaagagtcca
gctgcagagaggcgcagtggagcagtggctggaggccccgacacaccatcggcccagccc
ctcgggccccccgcactccagcctggtccaggcctttccacgaagagtcctcagccttct
ccctccagccggaagagccccctgagtctgagccctgcatttcaggtgcctttgggccca
gctgaacagggctcatccccactcctgagccctgtcctcagtgatgctggcggagccggg
atggactgcgaggagcccagacacaagcgcgtgcctgcagacgaggcctacttcatagtc
aaagagattctcgctacagaacgaacatacctcaaggatttagaagttattaccgtgtgg
ttccgcagcgcagtggtgaaggaggacgccatgcctgcgactctgatgacgctgctcttc
tccaacatcgatcccatctatgagttccacagaggcttcctgcgcgaggtggagcagagg
ctggcactctgggaagggccctccaaagcccacacaaaaggcagtcatcaacgaatcggg
gacatcctgctcaggaacatgcgccagttaaaggtgttccagctccacgaagggcatgta
gcaggggtcacaaaaatggagtag

DBGET integrated database retrieval system