KEGG   Homo sapiens (human): 9863Help
Entry
9863              CDS       T01001                                 

Gene name
MAGI2, ACVRIP1, AIP-1, AIP1, ARIP1, MAGI-2, SSCAM
Definition
membrane associated guanylate kinase, WW and PDZ domain containing 2
Orthology
K05629  
atrophin-1 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Tight junction
TNF signaling pathway
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21
AA seq 1455 aa AA seqDB search
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgccgagaatggacag
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagcaaattg
gtgtcggaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gacgtgctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaagaccttcgtcactacctcaacttacgatttcaaaagggttct
gtggaccatgagcttcagcaaatcattcgtgacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggattatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagac
aattactacggtaccccaaagccgccagcagaaccagcaccattattgttaaatgtaaca
gaccagatacttccaggagccactccaagtgctgaaggaaaacggaagaggaataaatca
gtgagcaacatggagaaagccagtatagagcctcctgaggaggaagaggaagagaggcct
gtggtcaatggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaaaagt
gcaggtgcctcaggggagatgccctcccagccttatcctgcaccagtgtacagtcagcct
gaggagctgaaggagcagatggatgacacaaagccaactaaacctgaagacaatgaggaa
ccagacccattgcctgataactgggaaatggcctatacagagaagggcgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
cctccagaagagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatccc
atttatggcacttattatgttgaccacataaatagaagaacacagtttgaaaatcctgtc
ctggaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaaaccactcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggctttggatttaccatc
attggtggagacgagcctgatgagtttctgcaggtgaaaagtgtgattccggatgggcct
gcagcacaggatggaaaaatggaaacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcag
agtgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgct
aacagcatggtgccaccccttgcaataatggagaggccacctccagtgatggtcaatgga
agacacaactatgaaacatatttggagtacatttctcggacctcacagtcagttccagat
ataacagatcggccgcctcattctctgcactccatgccaactgatggtcagctagacggc
acgtatccaccgcccgtccatgatgacaatgtgtctatggcttcatctggggccacccaa
gctgaacttatgaccttaaccattgtgaaaggtgcccagggcttcggcttcactattgcc
gacagtcctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctg
tgtgaaggcgacctcattgttgagatcaaccagcagaatgtacagaacctgagccataca
gaagtagtggatatacttaaggactgtcccattggaagtgaaacttctttgattatccat
cgaggaggtttcttttctccatggaaaactccaaagcctataatggaccgatgggagaat
caaggcagtcctcaaacgagtttatctgctccggccataccgcagaacctgcccttccca
cctgcccttcacaggagctcctttcctgactcaacagaggcctttgacccacggaagcct
gatccatatgagctctacgagaaatctagggccatttatgaaagtaggcaacaagtgcca
cccaggaccagttttcgaatggattcctctggtccagattataaggaattggatgttcat
cttcggaggatggagtctggatttggcttcagaatcctcgggggagatgagcctggacag
cctattttgattggagctgtcattgccatgggctcagccgacagagatggccgccttcac
ccaggagatgagcttgtgtatgttgatgggattccagtagccggcaaaacccaccgctat
gtcatcgacctcatgcaccacgcagcccgcaatgggcaggtcaacctcactgtgagaaga
aaggtgctatgtggaggggagccctgcccagagaacgggagaagtccaggctctgtatcc
acccaccacagctctccacgcagtgactacgcaacctacaccaacagcaaccacgctgcc
cccagtagcaatgcctctccccctgaaggcttcgcctcccacagcctgcagaccagtgat
gtggtcattcaccgcaaagagaatgagggcttcggctttgtcatcatcagctccctgaac
aggcctgagtctggatccactataactgtgccccataaaatcggacgcatcattgatggg
agtcctgcagatcgctgtgcaaaactaaaagtgggagaccggatcctagcagtgaatggc
cagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggatgcaggtctt
agtgtcacccttcgcatcattcctcaggaggagctcaacagccccacctcggcacccagc
tcagagaagcagagtcccatggcgcagcagagtcccctggcacagcagagtcccctggcc
cagccaagcccagccacccccaacagccccatcgcccagccagcaccacctcaaccactt
cagctgcaaggacacgaaaatagttacaggtcggaagtgaaagcaaggcaagatgtgaaa
ccagacatccgacagcctccattcacagactacaggcagcccccgctggattacaggcaa
cccccaggaggggactaccagcagcccccacccttggactacaggcagcctcccctactg
gactacaggcagcactcccccgacaccaggcagtaccctctgtcggactacagacaaccc
caggattttgattatttcactgtggacatggagaaaggagccaaaggatttggattcagc
attcgtggaggaagggaatacaaaatggatttgtatgtgttgagactggcagaagatgga
ccagcaataaggaatgggaggatgagggtaggagatcaaatcattgaaatcaatggggaa
agcacaagggacatgacacatgccagagcaatagaactcatcaaatctggaggaagacga
gtgaggctgctgctcaagagaggcacgggacaggtcccagaatatgacgaacccgccccc
tggagttctcccgctgccgccgccccaggtctgccggaagtaggcgtctccctggacgac
ggcctcgctccattctctccatcacatccagccccaccctccgacccttcccaccagata
agcccaggcccaacttgggatatcaaacgggaacacgacgttaggaaaccaaaggagctt
tcagcctgcggccagaagaagcagcgcctcggggagcagagggagcgctcggcgagtccg
cagagggccgcgcggccgaggctcgaggaggcgcccggcggccaggggcggcccgaggcc
ggcaggcccgcctcggaggccagggcgcccgggctcgcggcggcagacgcggcggacgcg
gcgcgggcgggcgggaaggaggcgccccgtgcggcggcgggctccgagctctgccggcgc
gaaggcccgggggctgcgccggcgtttgccggcccgggcggcggcggcagcggcgcgctg
gaggccgagggcagggcgggtgcgcgcgcgggtccccggccgggcccgcgacccccgggg
ggcgccccggcgcgcaaggccgccgtcgcgccggggccctggaaggtgccgggttctgac
aagctgcccagcgtcctcaaacccggcgcctcggccgccagcagatga

DBGET integrated database retrieval system