KEGG   Homo sapiens (human): 9863Help
Entry
9863              CDS       T01001                                 

Gene name
MAGI2, ACVRIP1, AIP-1, AIP1, ARIP1, MAGI-2, SSCAM
Definition
membrane associated guanylate kinase, WW and PDZ domain containing 2
Orthology
K05629  
atrophin-1 interacting protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Tight junction
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    9863 (MAGI2)
   04668 TNF signaling pathway
    9863 (MAGI2)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    9863 (MAGI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21
AA seq 1455 aa AA seqDB search
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccatgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgccgagaatggacag
ttcccctacctgggggaggtgaagcccggcaaggtggcctatgagagcggcagcaaattg
gtgtcggaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gacgtgctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaagaccttcgtcactacctcaacttacgatttcaaaagggttct
gtggaccatgagcttcagcaaatcattcgtgacaacctctacctccgcacggtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggattatattttcatcactgtt
gaagattttatggaattggagaaaagtggtgctctcctagaaagtgggacttatgaagac
aattactacggtaccccaaagccgccagcagaaccagcaccattattgttaaatgtaaca
gaccagatacttccaggagccactccaagtgctgaaggaaaacggaagaggaataaatca
gtgagcaacatggagaaagccagtatagagcctcctgaggaggaagaggaagagaggcct
gtggtcaatggaaatggagtagtagtaacaccagaatccagtgaacatgaagacaaaagt
gcaggtgcctcaggggagatgccctcccagccttatcctgcaccagtgtacagtcagcct
gaggagctgaaggagcagatggatgacacaaagccaactaaacctgaagacaatgaggaa
ccagacccattgcctgataactgggaaatggcctatacagagaagggcgaagtctacttc
attgaccataacacaaagacaacatcatggctggatccacgacttgcgaaaaaggctaaa
cctccagaagagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatccc
atttatggcacttattatgttgaccacataaatagaagaacacagtttgaaaatcctgtc
ctggaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggaacaaag
cccctgcaggccccaggtttccgagaaaaaccactcttcacccgggatgcatcccagttg
aagggaacattcctcagcaccaccctaaaaaagagcaacatgggctttggatttaccatc
attggtggagacgagcctgatgagtttctgcaggtgaaaagtgtgattccggatgggcct
gcagcacaggatggaaaaatggaaacaggtgatgtcattgtctatattaatgaagtttgt
gtccttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcag
agtgtcaacctggtgttgtgtcgtggctaccctttgccctttgatcctgaagaccctgct
aacagcatggtgccaccccttgcaataatggagaggccacctccagtgatggtcaatgga
agacacaactatgaaacatatttggagtacatttctcggacctcacagtcagttccagat
ataacagatcggccgcctcattctctgcactccatgccaactgatggtcagctagacggc
acgtatccaccgcccgtccatgatgacaatgtgtctatggcttcatctggggccacccaa
gctgaacttatgaccttaaccattgtgaaaggtgcccagggcttcggcttcactattgcc
gacagtcctacaggacagcgggtgaaacaaatacttgacattcagggatgccctggcctg
tgtgaaggcgacctcattgttgagatcaaccagcagaatgtacagaacctgagccataca
gaagtagtggatatacttaaggactgtcccattggaagtgaaacttctttgattatccat
cgaggaggtttcttttctccatggaaaactccaaagcctataatggaccgatgggagaat
caaggcagtcctcaaacgagtttatctgctccggccataccgcagaacctgcccttccca
cctgcccttcacaggagctcctttcctgactcaacagaggcctttgacccacggaagcct
gatccatatgagctctacgagaaatctagggccatttatgaaagtaggcaacaagtgcca
cccaggaccagttttcgaatggattcctctggtccagattataaggaattggatgttcat
cttcggaggatggagtctggatttggcttcagaatcctcgggggagatgagcctggacag
cctattttgattggagctgtcattgccatgggctcagccgacagagatggccgccttcac
ccaggagatgagcttgtgtatgttgatgggattccagtagccggcaaaacccaccgctat
gtcatcgacctcatgcaccacgcagcccgcaatgggcaggtcaacctcactgtgagaaga
aaggtgctatgtggaggggagccctgcccagagaacgggagaagtccaggctctgtatcc
acccaccacagctctccacgcagtgactacgcaacctacaccaacagcaaccacgctgcc
cccagtagcaatgcctctccccctgaaggcttcgcctcccacagcctgcagaccagtgat
gtggtcattcaccgcaaagagaatgagggcttcggctttgtcatcatcagctccctgaac
aggcctgagtctggatccactataactgtgccccataaaatcggacgcatcattgatggg
agtcctgcagatcgctgtgcaaaactaaaagtgggagaccggatcctagcagtgaatggc
cagtctatcatcaacatgcctcacgctgacatcgtgaagctcatcaaggatgcaggtctt
agtgtcacccttcgcatcattcctcaggaggagctcaacagccccacctcggcacccagc
tcagagaagcagagtcccatggcgcagcagagtcccctggcacagcagagtcccctggcc
cagccaagcccagccacccccaacagccccatcgcccagccagcaccacctcaaccactt
cagctgcaaggacacgaaaatagttacaggtcggaagtgaaagcaaggcaagatgtgaaa
ccagacatccgacagcctccattcacagactacaggcagcccccgctggattacaggcaa
cccccaggaggggactaccagcagcccccacccttggactacaggcagcctcccctactg
gactacaggcagcactcccccgacaccaggcagtaccctctgtcggactacagacaaccc
caggattttgattatttcactgtggacatggagaaaggagccaaaggatttggattcagc
attcgtggaggaagggaatacaaaatggatttgtatgtgttgagactggcagaagatgga
ccagcaataaggaatgggaggatgagggtaggagatcaaatcattgaaatcaatggggaa
agcacaagggacatgacacatgccagagcaatagaactcatcaaatctggaggaagacga
gtgaggctgctgctcaagagaggcacgggacaggtcccagaatatgacgaacccgccccc
tggagttctcccgctgccgccgccccaggtctgccggaagtaggcgtctccctggacgac
ggcctcgctccattctctccatcacatccagccccaccctccgacccttcccaccagata
agcccaggcccaacttgggatatcaaacgggaacacgacgttaggaaaccaaaggagctt
tcagcctgcggccagaagaagcagcgcctcggggagcagagggagcgctcggcgagtccg
cagagggccgcgcggccgaggctcgaggaggcgcccggcggccaggggcggcccgaggcc
ggcaggcccgcctcggaggccagggcgcccgggctcgcggcggcagacgcggcggacgcg
gcgcgggcgggcgggaaggaggcgccccgtgcggcggcgggctccgagctctgccggcgc
gaaggcccgggggctgcgccggcgtttgccggcccgggcggcggcggcagcggcgcgctg
gaggccgagggcagggcgggtgcgcgcgcgggtccccggccgggcccgcgacccccgggg
ggcgccccggcgcgcaaggccgccgtcgcgccggggccctggaaggtgccgggttctgac
aagctgcccagcgtcctcaaacccggcgcctcggccgccagcagatga

DBGET integrated database retrieval system