KEGG   Homo sapiens (human): 9869Help
Entry
9869              CDS       T01001                                 

Gene name
SETDB1, ESET, H3-K9-HMTase4, KG1T, KMT1E, TDRD21
Definition
SET domain, bifurcated 1 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 1291 aa AA seqDB search
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPS
ALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPL
LVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCL
DPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFIN
TGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYE
CNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEE
SNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVP
PSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRME
AEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKT
SMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGS
EGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQF
YDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccttcctgggtgcattggtttggatgcagcaacagctacagtggagtctgaa
gagattgcagagctgcaacaggcagtggttgaggaactgggtatctctatggaggaactt
cggcatttcatcgatgaggaactggagaagatggattgtgtacagcaacgcaagaagcag
ctagcagagttagagacatgggtaatacagaaagaatctgaggtggctcacgttgaccaa
ctctttgatgatgcatccagggcagtgactaattgtgagtctttggtgaaggacttctac
tccaagctgggactacaataccgggacagtagctctgaggacgaatcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaagtca
gctcaagatgttcagaagttcatggatgctgtcaacaagaagagcagttcccaggatctg
cataaaggaaccttgagtcagatgtctggagaactaagcaaagatggtgacctgatagtc
agcatgcgaattctgggcaagaagagaactaagacttggcacaaaggcacccttattgcc
atccagacagttgggccagggaagaaatacaaggtgaaatttgacaacaaaggaaagagt
ctactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtatgtg
ggcagtcgggtggtcgccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtcacacagtcggaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgtgacttcatagaggagtatgtcactgcctac
cccaaccgccccatggtactgctcaagagtggccagcttatcaagactgagtgggaaggc
acgtggtggaagtcccgagttgaggaggtggatggcagcctagtcaggatcctcttcctg
gatgacaaaagatgtgagtggatctatcgaggctctacacggctggagcccatgttcagc
atgaaaacatcctcagcctctgcactggagaagaagcaaggacagctcaggacacgtcca
aatatgggtgctgtgaggagcaaaggccctgttgtccagtacacacaggatctgaccggt
actggaacccagttcaagccagtggaacccccacagcctacagctccacctgccccacct
ttcccacctgctccacctctatccccccaagcaggtgacagtgacttggaaagccagctt
gcccagtcacggaagcaggtagccaaaaagagcacgtcctttcgaccaggatctgtgggc
tctggtcattcctcccctacatctcctgcactcagtgaaaatgtctctggtgggaaacct
gggatcaaccagacatatagatcacctttaggctccacagcctctgccccagcaccctca
gcactcccggcccctccagcacccccagtcttccatggcatgctggagcgggccccagca
gagccctcctaccgtgctcccatggagaagcttttctacttacctcatgtctgcagctat
acctgtctgtctcgagtcagacctatgaggaatgagcagtaccggggcaagaaccctctg
ctggtcccgttactatatgacttccggcggatgacagcccggcgtcgagttaaccgcaag
atgggctttcatgttatctataagacaccttgtggtctctgccttcggacaatgcaggag
atagaacgctaccttttcgagactggctgtgacttcctcttcctggagatgttctgtttg
gatccatatgttcttgtggaccgaaagtttcagccctataagcctttttactatattttg
gacatcacttatgggaaggaagatgttcccctatcctgtgtcaatgagattgacacaacc
cctccaccccaggtggcctacagcaaggaacgtatcccgggcaagggtgttttcattaac
acaggccctgaatttctggttggctgtgactgcaaggatgggtgtcgggacaagtccaag
tgtgcctgccatcaactaactatccaggctacagcctgtaccccaggaggccaaatcaac
cctaactctggctaccagtacaagagactagaagagtgtctacccacaggggtatatgag
tgtaacaaacgctgcaaatgtgacccaaacatgtgcacaaaccggttggtgcaacatgga
ctacaagttcggctacagctattcaagacacagaacaagggctggggtatccgctgcttg
gatgacattgccaaaggctcttttgtttgtatttatgcaggcaaaatcctgacagatgac
tttgcagacaaggagggtctggaaatgggtgatgagtactttgcaaatctggaccatatc
gagagcgtggagaacttcaaagaaggatatgagagtgatgccccctgttcctctgacagc
agtggtgtagacttgaaggaccaggaagatggcaacagcggtacagaggaccctgaagag
tccaatgatgatagctcagatgataacttctgtaaggatgaggacttcagcaccagttca
gtgtggcggagctatgctacccggaggcagacccggggccagaaagagaacggactctct
gagacaacttccaaggactcccaccccccagatcttggacccccacatattcctgttcct
ccctcaatccctgtaggtggctgcaatccaccttcctccgaagagacacccaagaacaag
gtggcctcatggttgagctgcaatagtgtcagtgaaggtggttttgctgactctgatagc
cattcatccttcaagactaatgaaggtggggagggccgggctgggggaagccgaatggag
gctgagaaggcctccacctcaggactaggcatcaaggatgagggagacatcaaacaggcc
aagaaagaggacactgacgaccgaaacaagatgtcagtagttactgaaagctctcgaaat
tacggttacaatccttctcctgtgaagcctgaaggacttcgccgcccacctagtaagact
agtatgcatcaaagccgaagactcatggcttctgctcagtccaaccctgatgatgtcctg
acactgtccagcagcacagaaagtgagggggaaagtgggaccagccgaaagcccactgct
ggtcagacttcggctacagcggttgacagtgatgatatccagaccatatcctctggctct
gaaggggatgactttgaggacaagaagaacatgactggtccaatgaagcgtcaagtggca
gtaaaatcaacccgaggctttgctcttaaatcaacccatgggattgcaattaaatcaacc
aacatggcctctgtggacaagggggagagcgcacctgttcgtaagaacacacgccaattc
tatgatggcgaggagtcttgctacatcattgatgccaagcttgaaggcaacctgggccgc
tacctcaaccacagttgcagccccaacctgtttgtccagaatgtcttcgtggatacccat
gatcttcgcttcccctgggtggccttctttgccagcaaaagaatccgggctgggacagaa
cttacttgggactacaactacgaggtgggcagtgtggaaggcaaggagctactctgttgc
tgtggggccattgaatgcagaggacgtcttctttag

DBGET integrated database retrieval system