KEGG   Homo sapiens (human): 9869Help
Entry
9869              CDS       T01001                                 

Gene name
SETDB1, ESET, H3-K9-HMTase4, KG1T, KMT1E, TDRD21
Definition
(RefSeq) SET domain, bifurcated 1 (EC:2.1.1.43)
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    9869 (SETDB1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    9869 (SETDB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     9869 (SETDB1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     9869 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    9869 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 1291 aa AA seqDB search
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPS
ALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPL
LVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCL
DPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFIN
TGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYE
CNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEE
SNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVP
PSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRME
AEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKT
SMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGS
EGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQF
YDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccttcctgggtgcattggtttggatgcagcaacagctacagtggagtctgaa
gagattgcagagctgcaacaggcagtggttgaggaactgggtatctctatggaggaactt
cggcatttcatcgatgaggaactggagaagatggattgtgtacagcaacgcaagaagcag
ctagcagagttagagacatgggtaatacagaaagaatctgaggtggctcacgttgaccaa
ctctttgatgatgcatccagggcagtgactaattgtgagtctttggtgaaggacttctac
tccaagctgggactacaataccgggacagtagctctgaggacgaatcttcccggcctaca
gaaataattgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaagtca
gctcaagatgttcagaagttcatggatgctgtcaacaagaagagcagttcccaggatctg
cataaaggaaccttgagtcagatgtctggagaactaagcaaagatggtgacctgatagtc
agcatgcgaattctgggcaagaagagaactaagacttggcacaaaggcacccttattgcc
atccagacagttgggccagggaagaaatacaaggtgaaatttgacaacaaaggaaagagt
ctactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtatgtg
ggcagtcgggtggtcgccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtcacacagtcggaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgtgacttcatagaggagtatgtcactgcctac
cccaaccgccccatggtactgctcaagagtggccagcttatcaagactgagtgggaaggc
acgtggtggaagtcccgagttgaggaggtggatggcagcctagtcaggatcctcttcctg
gatgacaaaagatgtgagtggatctatcgaggctctacacggctggagcccatgttcagc
atgaaaacatcctcagcctctgcactggagaagaagcaaggacagctcaggacacgtcca
aatatgggtgctgtgaggagcaaaggccctgttgtccagtacacacaggatctgaccggt
actggaacccagttcaagccagtggaacccccacagcctacagctccacctgccccacct
ttcccacctgctccacctctatccccccaagcaggtgacagtgacttggaaagccagctt
gcccagtcacggaagcaggtagccaaaaagagcacgtcctttcgaccaggatctgtgggc
tctggtcattcctcccctacatctcctgcactcagtgaaaatgtctctggtgggaaacct
gggatcaaccagacatatagatcacctttaggctccacagcctctgccccagcaccctca
gcactcccggcccctccagcacccccagtcttccatggcatgctggagcgggccccagca
gagccctcctaccgtgctcccatggagaagcttttctacttacctcatgtctgcagctat
acctgtctgtctcgagtcagacctatgaggaatgagcagtaccggggcaagaaccctctg
ctggtcccgttactatatgacttccggcggatgacagcccggcgtcgagttaaccgcaag
atgggctttcatgttatctataagacaccttgtggtctctgccttcggacaatgcaggag
atagaacgctaccttttcgagactggctgtgacttcctcttcctggagatgttctgtttg
gatccatatgttcttgtggaccgaaagtttcagccctataagcctttttactatattttg
gacatcacttatgggaaggaagatgttcccctatcctgtgtcaatgagattgacacaacc
cctccaccccaggtggcctacagcaaggaacgtatcccgggcaagggtgttttcattaac
acaggccctgaatttctggttggctgtgactgcaaggatgggtgtcgggacaagtccaag
tgtgcctgccatcaactaactatccaggctacagcctgtaccccaggaggccaaatcaac
cctaactctggctaccagtacaagagactagaagagtgtctacccacaggggtatatgag
tgtaacaaacgctgcaaatgtgacccaaacatgtgcacaaaccggttggtgcaacatgga
ctacaagttcggctacagctattcaagacacagaacaagggctggggtatccgctgcttg
gatgacattgccaaaggctcttttgtttgtatttatgcaggcaaaatcctgacagatgac
tttgcagacaaggagggtctggaaatgggtgatgagtactttgcaaatctggaccatatc
gagagcgtggagaacttcaaagaaggatatgagagtgatgccccctgttcctctgacagc
agtggtgtagacttgaaggaccaggaagatggcaacagcggtacagaggaccctgaagag
tccaatgatgatagctcagatgataacttctgtaaggatgaggacttcagcaccagttca
gtgtggcggagctatgctacccggaggcagacccggggccagaaagagaacggactctct
gagacaacttccaaggactcccaccccccagatcttggacccccacatattcctgttcct
ccctcaatccctgtaggtggctgcaatccaccttcctccgaagagacacccaagaacaag
gtggcctcatggttgagctgcaatagtgtcagtgaaggtggttttgctgactctgatagc
cattcatccttcaagactaatgaaggtggggagggccgggctgggggaagccgaatggag
gctgagaaggcctccacctcaggactaggcatcaaggatgagggagacatcaaacaggcc
aagaaagaggacactgacgaccgaaacaagatgtcagtagttactgaaagctctcgaaat
tacggttacaatccttctcctgtgaagcctgaaggacttcgccgcccacctagtaagact
agtatgcatcaaagccgaagactcatggcttctgctcagtccaaccctgatgatgtcctg
acactgtccagcagcacagaaagtgagggggaaagtgggaccagccgaaagcccactgct
ggtcagacttcggctacagcggttgacagtgatgatatccagaccatatcctctggctct
gaaggggatgactttgaggacaagaagaacatgactggtccaatgaagcgtcaagtggca
gtaaaatcaacccgaggctttgctcttaaatcaacccatgggattgcaattaaatcaacc
aacatggcctctgtggacaagggggagagcgcacctgttcgtaagaacacacgccaattc
tatgatggcgaggagtcttgctacatcattgatgccaagcttgaaggcaacctgggccgc
tacctcaaccacagttgcagccccaacctgtttgtccagaatgtcttcgtggatacccat
gatcttcgcttcccctgggtggccttctttgccagcaaaagaatccgggctgggacagaa
cttacttgggactacaactacgaggtgggcagtgtggaaggcaaggagctactctgttgc
tgtggggccattgaatgcagaggacgtcttctttag

DBGET integrated database retrieval system