KEGG   Homo sapiens (human): 988Help
Entry
988               CDS       T01001                                 

Gene name
CDC5L, CDC5, CDC5-LIKE, CEF1, PCDC5RP, dJ319D22.1
Definition
cell division cycle 5-like
Orthology
K12860  
pre-mRNA-splicing factor CDC5/CEF1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, Prp19/CDC5L complex
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    988 (CDC5L)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    988 (CDC5L)
 Complex C
   Prp19-CDC5 complex
    988 (CDC5L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21
AA seq 802 aa AA seqDB search
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaattatgatcaaggggggcgtatggaggaataccgaggatgaaattctgaaa
gcagcggtaatgaaatatgggaaaaatcagtggtctaggattgcctcattgctgcataga
aaatcagcaaagcagtgcaaagccagatggtatgaatggctggatccaagcattaagaag
acagaatggtccagagaagaagaggaaaaactcttgcacttggccaagttgatgccaact
cagtggaggaccattgctccaatcattggaagaacagcggcccagtgcttagaacactat
gaatttcttctggataaagctgcccaaagagacaatgaagaggaaacaacagatgatcca
cgaaaacttaaacctggagaaatagatccaaatccagaaacaaaaccagcgcggcctgat
ccaattgatatggatgaggatgaacttgagatgctttctgaagccagagcccgcttggct
aatactcagggaaagaaggccaagaggaaagcaagagagaaacaattggaagaagcaaga
cgtcttgctgccctccaaaaaagaagagaacttcgagcagctggcatagaaattcagaag
aaaagaaaaaggaagagaggagttgattataatgccgaaatcccatttgaaaaaaagcct
gcccttggtttttatgatacttctgaggaaaactaccaagctcttgacgcagatttcagg
aaattaagacaacaggatcttgatggggagctaagatctgaaaaagaaggaagagataga
aaaaaagacaaacagcatttgaaaaggaaaaaagaatctgatttaccatcagctattctt
caaactagtggtgtttctgaatttactaaaaagagaagcaaactagtacttcctgcccct
cagatttcagatgcagaactccaggaagttgtaaaagtaggccaagcgagtgaaattgca
cgtcaaactgccgaggaatctggcataacaaattctgcttccagtacacttttgtctgag
tacaatgtcaccaacaacagcgttgctcttagaacaccacgaacaccagcttcccaggac
agaattctgcaggaagcccagaacctcatggccctcaccaatgtggacaccccattgaaa
ggtggacttaataccccattgcatgagagtgacttctcaggtgtaactccacagcgacaa
gttgtacagactccaaacacagttctctctactccattcaggactccttctaatggagct
gaagggctgactccccggagtggaacaactcccaaaccagttattaactctactccgggt
agaactcctcttcgagacaagttaaacattaatcccgaggatggaatggcagactatagt
gatccctcttacgtgaagcagatggaaagagaatcccgagaacatctccgtttagggttg
ttgggccttcctgcccctaagaatgattttgaaattgttctaccagaaaatgccgagaag
gagctggaagaacgtgaaatagatgatacttacattgaagatgctgctgatgtggatgct
cgaaagcaggccatacgagatgcagagcgtgtaaaggaaatgaaacgaatgcataaagct
gtccagaaagatctgccaagaccatcagaagtaaatgaaactattctaagacccttaaat
gtagaaccgcctttaacagatttacagaaaagtgaagaactaatcaaaaaagaaatgatc
acaatgcttcattatgaccttctacatcacccttatgaaccatctggaaataaaaaaggc
aaaactgtagggtttggtaccaataattcagagcacattacctatctggaacataatcct
tatgaaaagttctccaaagaagagctgaaaaaggcccaggatgttttggtgcaggagatg
gaagtggttaaacaaggaatgagccatggagagctctcaagtgaagcttataaccaggtg
tgggaagaatgctacagtcaagttttatatcttcctgggcagagccgctacacacgggcc
aatctggctagtaaaaaggacagaattgaatcacttgaaaagaggctcgagataaacagg
ggtcacatgacgacagaagccaagagggctgcaaagatggaaaagaagatgaaaattttg
cttgggggttaccagtctcgtgctatggggctcatgaaacagttgaatgacttatgggac
caaattgaacaggctcacttggagttacgcacttttgaagaactcaagaaacatgaagat
tctgctattccccggaggctagagtgtctaaaagaagacgttcagcgacaacaagaaaga
gaaaaggaacttcaacatagatatgctgatttgctgctggagaaagagactttaaagtca
aaattctga

DBGET integrated database retrieval system