KEGG   Homo sapiens (human): 9883Help
Entry
9883              CDS       T01001                                 

Gene name
POM121, P145, POM121A
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    9883 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 999 aa AA seqDB search
MVCSPVTVRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKEKKRTV
EEEDQIFLDGQENKRRRHDSSGSGHSAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHL
NKRSRSSSMSSLTGAYASGIPSSSRNAITSSYSSTRGISQLWKRNGPSSSPFSSPASSRS
QTPERPAKKIREEELCHHSSSSTPLAADRESQGEKAADTTPRKKQNSNSQSTPGSSGQRK
RKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASNSVTET
PPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEAL
SPPKTPSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAE
TATKPQATSAPSPAPKQSFLFGTQNTSPSSPAAPAASSAPPMFKPIFTAPPKSEKEGPTP
PGPSVTATAPSSSSLPTTTSTTAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTA
PLFTGLASATSAVAPITSASPSTDSASKPAFGFGINSVSSSSVSTTTSTATAASQPFLFG
APQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLHTAVPTATSSSAADFSGFGSTL
ATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKP
ALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATAS
AFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAP
AGSGSFGINVATPGSSTTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNV
SSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGNTFAHQQ
EHSPRKGPNNLSKRKLLPAVRAQGLPRRGQASSFPTRKE
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtagcccagtgactgtgaggatcgcccctcctgacagaagattttcgcgttct
gcgataccagagcagataatcagctcaacactgtcctcaccatcaagtaacgccccagac
ccatgtgcaaaggagacagtactgagtgccctcaaagagaaggagaagaaaaggacagtg
gaggaagaagaccaaatattccttgatggccaggaaaataaaagaaggcgccatgatagc
agtggcagtggacattcagcatttgagcccctggtggccaatggagtccccgcttctttt
gtgcctaagcctgggtctctgaagagaggcctcaattctcagagctcagatgaccacttg
aataagagatcccgaagctcttccatgagctccttgacaggcgcttacgcaagtggcatc
cctagctccagccgcaatgccattaccagttcctacagctccactcgaggcatctcacag
ctctggaagagaaatggccccagttcatcacccttctctagcccagcctcctcccgctcc
cagacaccggagaggccagcaaagaaaataagagaagaggagctgtgtcatcattccagt
tcttcaactccattggcagcagacagggagtcccagggagaaaaggctgcagatacaacc
ccaaggaagaaacaaaactcgaattctcagtctacacctggcagctctgggcagcgtaag
cggaaagttcagctgctgccttctcggcgaggggaacagctgaccttgcctccacctccc
cagcttggctattcgatcactgccgaggacctagacttagagaagaaggcttcattacag
tggttcaaccaggccttggaggacaagagcgatgctgcctcgaactctgtcactgagacc
ccacctatcactcagccttcatttacctttaccctgcctgctgctgcacctgcctcccca
cccacctccctcctggccccaagcaccaacccactgttagagagcttgaagaagatgcag
actcccccgagcctgccaccctgcccagaatctgctggagcagcaaccactgaggccctc
tcacctccaaagacacccagcctcctacccccgctgggtttatcacagtcagggccgcca
gggctgctccccagcccctcctttgactccaaacccccgaccactttgctggggctgatc
cctgctccatccatggtaccagccactgacaccaaggcacctccaacccttcaggcagag
acggctaccaaaccccaagccacatctgccccgtcccccgcccccaagcaaagcttcctg
tttggaacacagaacacctcaccttccagccctgccgcccctgctgcatcttcagcacct
cccatgttcaagcccattttcacggctccacccaagagtgagaaggaaggccccacaccg
cctggcccttcagtcacagccacagcgccctccagctcctccctccccacgaccaccagc
accacagccccgaccttccagcctgtctttagcagcatggggccacctgcatctgtgccc
ttgcctgctcccttcttcaagcagacaactactcccgccactgctcccaccacaactgcc
ccgctcttcactggcctggccagcgccacctctgctgtggctcccatcacctctgccagt
ccatccacagactctgcttcgaagcctgcgtttggctttggcataaacagtgtgagcagc
agcagtgtgagtaccacgaccagcaccgccactgccgcctcacagcctttcctcttcggg
gcgccccaggcctctgctgccagcttcaccccggccatgggctccatattccagtttggc
aaacctcctgccttgcccacaaccaccacagtcaccaccttcagccagtccctgcacact
gccgtgccaacggccaccagcagcagcgctgccgactttagtggttttggcagcaccctc
gccacctccgccccggccaccagcagccagcccactctgacgttcagtaacacgagcacc
cccacgttcaacattccctttggctcaagcgccaagtccccgctcccatcatatccggga
gccaacccccagcccgcatttggggccgctgaggggcagccaccgggggccgccaagccg
gcccttgcccccagctttggcagctctttcacttttggaaactctgcagccccggctgct
gcacccacacctgcacctccgtccatgatcaaggtcgtgcctgcgtacgtgcctacgccc
atccatcctatctttggcggtgccacgcactcggcgtttgggttgaaagccacggcttcg
gccttcggcgctcccgccagctcacagcccgcctttggcggctccactgctgtcttcttc
ggtgcagccaccagctccggctttggagccaccacccagaccgccagcagcgggagcagc
agctcggtgtttggcagcacaacaccatcacccttcacgtttgggggttcggcagccccc
gctggcagtgggagctttgggatcaatgtggccaccccaggctccagcaccaccaccgga
gctttcagctttggagcaggacagagtgggagcacagccacctccacccccttcgcaggg
ggcttaggtcagaacgccctgggcaccaccggccagagcacaccgtttgccttcaacgtg
agcagcacaactgagagcaaacctgtgtttggaggcaccgccacccccacctttggtctg
aacacccctgcgcctggagtgggcacatcaggcagcagcctctcctttggggcatcctca
gcacccgcccaaggctttgttggtgttgcacctttcggcaacacttttgctcaccagcaa
gaacacagcccgaggaagggacccaataacctttcaaaacgcaaactgctgcctgcggtg
agggcccagggtcttccacggagaggacaggcatcttcctttcccaccaggaaggagtga

DBGET integrated database retrieval system