KEGG   Homo sapiens (human): 9887Help
Entry
9887              CDS       T01001                                 

Gene name
SMG7, C1orf16, EST1C, SGA56M
Definition
(RefSeq) SMG7, nonsense mediated mRNA decay factor (EC:2.7.11.1)
  KO
K14409  
protein SMG7
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    9887 (SMG7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     9887 (SMG7)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     9887 (SMG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25
AA seq 1137 aa AA seqDB search
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDL
WNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCR
VKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQ
LVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEV
KTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVI
NLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYP
LPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFE
LQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEV
GKLLFITEIPELILEDPSEAKENLILQETSVIESLAADGSPGLKSVLSTSRNLSNNCDTG
EKPVVTFKENIKTREVNRDQGRSFPPKEVRRDYSKGITVTKNDGKKDNNKRKTETKKCTL
EKLQETGKQNVAVQVKSQTELRKTPVSEARKTPVTQTPTQASNSQFIPIHHPGAFPPLPS
RPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTAHSPAGNQVQAGKQSHIPYSQ
QRPSGPGPMNQGPQQSQPPSQQPLTSLPAQPTAQSTSQLQVQALTQQQQSPTKAVPALGK
SPPHHSGFQQYQQADASKQLWNPPQVQGPLGKIMPVKQPYYLQTQDPIKLFEPSLQPPVM
QQQPLEKKMKPFPMEPYNHNPSEVKVPEFYWDSSYSMADNRSVMAQQANIDRRGKRSPGV
FRPEQDPVPRMPFEKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMFNEVYGKNLTS
SSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPASQSPHSSNPSSLPSSPPTHN
HNSVPFSNFGPIGTPDNRDRRTADRWKTDKPAMGGFGIDYLSATSSSESSWHQASTPSGT
WTGHGPSMEDSSAVLMESLKSIWSSSMMHPGPSALEQLLMQQKQKQQRGQGTMNPPH
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcagagcgcgcagtacctccggcaggcagaagtcctgaaggctgacatgaca
gattctaagctgggtccagctgaagtctggacatccaggcaggctctgcaggacctgtac
cagaaaatgctagttaccgatttggaatacgctttagacaagaaagtagaacaggatctc
tggaatcacgcctttaagaatcagatcacaacactgcaaggccaggcaaagaatcgagca
aatccgaatcggagtgaagttcaggcaaacctttctctgttcctagaggcagctagtggc
ttctatactcagttattacaagaactgtgtacagtatttaatgtagatttaccatgccgt
gtgaagtcttcccaattgggaattatcagcaataaacagacgcataccagcgccatagtg
aagccacagtctagctcctgttcctatatctgccagcactgcctcgtccaccttggagac
attgctcgatacagaaaccagaccagccaggcagagtcctactataggcatgcagctcag
cttgtcccctccaatggtcagccttataatcagttggctatcttagcttcttccaaagga
gaccatctgaccacaattttctactactgcagaagcattgctgtgaagttccctttccca
gctgcctccactaatctgcaaaaagcactttctaaagcactggaaagccgagatgaggtg
aaaaccaagtggggtgtttctgacttcatcaaggcctttattaaattccacggtcatgtg
tacctgagtaagagcttggaaaagttgagccctcttcgagagaaattggaagaacagttt
aagaggctgctattccaaaaagctttcaactctcagcagttagttcatgtcactgtcatt
aacctgtttcaacttcatcaccttcgtgactttagcaatgaaaccgagcagcacacttat
agccaagatgagcagctatgttggacacagttgctggccctctttatgtcttttcttggc
atcctgtgcaagtgtcctctacagaatgagtctcaggaggagtcctacaatgcctatcct
cttccagcagtcaaggtctccatggactggctaagactcagacccagggtctttcaggag
gcagtggtggatgaaagacagtacatttggccctggttgatttctcttctgaatagtttc
catccccatgaagaggacctctcaagtattagtgcgacaccacttccagaggagtttgaa
ttacaaggatttttggcattgagaccttctttcaggaacttggatttttccaaaggtcac
cagggtattacaggggacaaagaaggccagcaacgacgaatacgacagcaacgcttgatc
tctataggcaaatggattgctgataatcagccaaggctgattcagtgtgaaaatgaggta
gggaaattgttgtttatcacagaaatcccagaattaatactggaagaccccagtgaagcc
aaagagaacctcattctgcaagaaacatctgtgatagagtcgctggctgcagatgggagc
ccagggctaaaatcagtgctatctacaagccgaaatttaagcaacaactgtgacacagga
gagaagccagtggttaccttcaaagaaaacattaagacacgagaagtgaacagagaccaa
ggaagaagttttcctcccaaagaggtgagaagggactatagcaaaggaataactgtaact
aagaatgatggaaagaaggacaacaacaagaggaaaactgaaaccaagaaatgcacctta
gaaaagttacaggaaacaggaaagcagaatgtggcagtgcaggtaaaatcccagacagaa
ctaagaaagactccagtgtctgaagccagaaaaacacctgtaactcaaaccccaactcaa
gcaagtaactcccagttcatccccattcatcaccctggagccttccctcctcttcccagc
aggccagggtttccgcccccaacatatgttatccccccgcctgtggcattttctatgggc
tcaggttacaccttcccagctggtgtttctgtcccaggaacctttcttcagcctacagct
cactctccagcaggaaaccaggtgcaagctgggaaacagtcccacattccttacagccag
caacggccctctggaccagggccaatgaaccagggacctcaacaatcacagccaccttcc
cagcaaccccttacatctttaccagctcagccaacagcacagtctacaagccagctgcag
gttcaagctctaactcagcaacaacaatcccctacaaaagctgtgccggctttggggaaa
agcccgcctcaccactctggattccagcagtatcaacaggcagatgcctccaaacagctg
tggaatccccctcaggttcaaggcccattagggaaaattatgcctgtgaaacagccctac
taccttcagacccaagaccccataaaactgtttgagccgtcattgcaacctcctgtaatg
cagcagcagcctctagaaaaaaaaatgaagccttttcccatggagccatataaccataat
ccctcagaagtcaaggtcccagaattctactgggattcttcctacagcatggctgataac
agatctgtaatggcacagcaagcaaacatagaccgcaggggcaaacggtcaccaggagtc
ttccgtccagagcaggatcctgtacccagaatgccgtttgagaaatccttattggagaag
ccctcagagctcatgtcacattcatcctctttcctgtccctcaccggattctctctcaat
caggaaagatacccaaataatagtatgttcaatgaggtatatgggaaaaacctgacatcc
agctccaaagcagaactcagtccctcaatggccccccaggaaacatctctgtattccctt
tttgaagggactccgtggtctccatcacttcctgccagttcagatcattcaacaccagcc
agccagtctcctcattcctctaacccaagcagcctacccagctctcctccaacacacaac
cataattctgttccattctccaattttggacccattgggactccagataacagggataga
aggactgcagatcggtggaaaactgataagccagccatgggtgggtttggcattgattat
ctctcagcaacgtcatcctctgagagcagttggcatcaggccagcactccgagtggcacc
tggacaggccatggcccttccatggaggattcctctgctgtcctcatggaaagcctaaag
tctatctggtccagttccatgatgcatcctggaccttctgctctggagcagctgttaatg
cagcagaagcagaaacagcaacggggacaaggcaccatgaaccctccacactga

DBGET integrated database retrieval system