KEGG   Homo sapiens (human): 9887Help
Entry
9887              CDS       T01001                                 

Gene name
SMG7, C1orf16, EST1C, SGA56M
Definition
SMG7 nonsense mediated mRNA decay factor (EC:2.7.11.1)
Orthology
K14409  
protein SMG7
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25
AA seq 1145 aa AA seqDB search
MLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFY
TQLLQELCTVFNVDLPCRVKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIA
RYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAA
STNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKR
LLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGIL
CKCPLQNESQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHP
HEEDLSSISATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISI
GKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEAKENLILQETSVIESLAADGSPG
LKSVLSTSRNLSNNCDTGEKPVVTFKENIKTREVNRDQGRSFPPKEVRRDYSKGITVTKN
DGKKDNNKRKTETKKCTLEKLQETGKQNVAVQVKSQTELRKTPVSEARKTPVTQTPTQAS
NSQFIPIHHPGAFPPLPSRPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTAHS
PAGNQVQAGKQSHIPYSQQRPSGPGPMNQGPQQSQPPSQQPLTSLPAQPTAQSTSQLQVQ
ALTQQQQSPTKAVPALGKSPPHHSGFQQYQQADASKQLWNPPQVQGPLGKIMPVKQPYYL
QTQDPIKLFEPSLQPPVMQQQPLEKKMKPFPMEPYNHNPSEVKVPEFYWDSSYSMADNRS
VMAQQANIDRRGKRSPGVFRPEQDPVPRMPFEDPKSSPLLPPDLLKSLAALEEEEELIFS
NPPDLYPALLGPLASLPGRSLFKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMFNE
VYGKNLTSSSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPASQSPHSSNPSSL
PSSPPTHNHNSVPFSNFGPIGTPDNRDRRTADRWKTDKPAMGGFGIDYLSATSSSESSWH
QASTPSGTWTGHGPSMEDSSAVLMESLKSIWSSSMMHPGPSALEQLLMQQKQKQQRGQGT
MNPPH
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgctagttaccgatttggaatacgctttagacaagaaagtagaacaggatctctggaat
cacgcctttaagaatcagatcacaacactgcaaggccaggcaaagaatcgagcaaatccg
aatcggagtgaagttcaggcaaacctttctctgttcctagaggcagctagtggcttctat
actcagttattacaagaactgtgtacagtatttaatgtagatttaccatgccgtgtgaag
tcttcccaattgggaattatcagcaataaacagacgcataccagcgccatagtgaagcca
cagtctagctcctgttcctatatctgccagcactgcctcgtccaccttggagacattgct
cgatacagaaaccagaccagccaggcagagtcctactataggcatgcagctcagcttgtc
ccctccaatggtcagccttataatcagttggctatcttagcttcttccaaaggagaccat
ctgaccacaattttctactactgcagaagcattgctgtgaagttccctttcccagctgcc
tccactaatctgcaaaaagcactttctaaagcactggaaagccgagatgaggtgaaaacc
aagtggggtgtttctgacttcatcaaggcctttattaaattccacggtcatgtgtacctg
agtaagagcttggaaaagttgagccctcttcgagagaaattggaagaacagtttaagagg
ctgctattccaaaaagctttcaactctcagcagttagttcatgtcactgtcattaacctg
tttcaacttcatcaccttcgtgactttagcaatgaaaccgagcagcacacttatagccaa
gatgagcagctatgttggacacagttgctggccctctttatgtcttttcttggcatcctg
tgcaagtgtcctctacagaatgagtctcaggaggagtcctacaatgcctatcctcttcca
gcagtcaaggtctccatggactggctaagactcagacccagggtctttcaggaggcagtg
gtggatgaaagacagtacatttggccctggttgatttctcttctgaatagtttccatccc
catgaagaggacctctcaagtattagtgcgacaccacttccagaggagtttgaattacaa
ggatttttggcattgagaccttctttcaggaacttggatttttccaaaggtcaccagggt
attacaggggacaaagaaggccagcaacgacgaatacgacagcaacgcttgatctctata
ggcaaatggattgctgataatcagccaaggctgattcagtgtgaaaatgaggtagggaaa
ttgttgtttatcacagaaatcccagaattaatactggaagaccccagtgaagccaaagag
aacctcattctgcaagaaacatctgtgatagagtcgctggctgcagatgggagcccaggg
ctaaaatcagtgctatctacaagccgaaatttaagcaacaactgtgacacaggagagaag
ccagtggttaccttcaaagaaaacattaagacacgagaagtgaacagagaccaaggaaga
agttttcctcccaaagaggtgagaagggactatagcaaaggaataactgtaactaagaat
gatggaaagaaggacaacaacaagaggaaaactgaaaccaagaaatgcaccttagaaaag
ttacaggaaacaggaaagcagaatgtggcagtgcaggtaaaatcccagacagaactaaga
aagactccagtgtctgaagccagaaaaacacctgtaactcaaaccccaactcaagcaagt
aactcccagttcatccccattcatcaccctggagccttccctcctcttcccagcaggcca
gggtttccgcccccaacatatgttatccccccgcctgtggcattttctatgggctcaggt
tacaccttcccagctggtgtttctgtcccaggaacctttcttcagcctacagctcactct
ccagcaggaaaccaggtgcaagctgggaaacagtcccacattccttacagccagcaacgg
ccctctggaccagggccaatgaaccagggacctcaacaatcacagccaccttcccagcaa
ccccttacatctttaccagctcagccaacagcacagtctacaagccagctgcaggttcaa
gctctaactcagcaacaacaatcccctacaaaagctgtgccggctttggggaaaagcccg
cctcaccactctggattccagcagtatcaacaggcagatgcctccaaacagctgtggaat
ccccctcaggttcaaggcccattagggaaaattatgcctgtgaaacagccctactacctt
cagacccaagaccccataaaactgtttgagccgtcattgcaacctcctgtaatgcagcag
cagcctctagaaaaaaaaatgaagccttttcccatggagccatataaccataatccctca
gaagtcaaggtcccagaattctactgggattcttcctacagcatggctgataacagatct
gtaatggcacagcaagcaaacatagaccgcaggggcaaacggtcaccaggagtcttccgt
ccagagcaggatcctgtacccagaatgccgtttgaggaccccaagagctcccctctgctt
cctccggacctgttaaagagtctggctgccttggaggaagaggaagagctgattttttct
aaccctcctgatctttacccggctctgctggggcctctcgcctctcttcctggacgaagc
ctttttaaatccttattggagaagccctcagagctcatgtcacattcatcctctttcctg
tccctcaccggattctctctcaatcaggaaagatacccaaataatagtatgttcaatgag
gtatatgggaaaaacctgacatccagctccaaagcagaactcagtccctcaatggccccc
caggaaacatctctgtattccctttttgaagggactccgtggtctccatcacttcctgcc
agttcagatcattcaacaccagccagccagtctcctcattcctctaacccaagcagccta
cccagctctcctccaacacacaaccataattctgttccattctccaattttggacccatt
gggactccagataacagggatagaaggactgcagatcggtggaaaactgataagccagcc
atgggtgggtttggcattgattatctctcagcaacgtcatcctctgagagcagttggcat
caggccagcactccgagtggcacctggacaggccatggcccttccatggaggattcctct
gctgtcctcatggaaagcctaaagtctatctggtccagttccatgatgcatcctggacct
tctgctctggagcagctgttaatgcagcagaagcagaaacagcaacggggacaaggcacc
atgaaccctccacactga

DBGET integrated database retrieval system