KEGG   Homo sapiens (human): 9896Help
Entry
9896              CDS       T01001                                 

Gene name
FIG4, ALS11, BTOP, CMT4J, KIAA0274, SAC3, YVS, dJ249I4.1
Definition
(RefSeq) FIG4 phosphoinositide 5-phosphatase
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00264  
Charcot-Marie-Tooth disease (CMT)
H00271  
Polymicrogyria
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92562(Tbio)
UniProt: 
Position
6q21
AA seq 907 aa AA seqDB search
MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQ
QEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIG
GHAIYKVEDTNMIYIPNDSVRVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT
VLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELLDIIKS
TVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVE
TEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALH
FDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAK
YTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTG
ILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDT
LSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHP
TEGKPHLWELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLI
VKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDE
TGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVK
MTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCS
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE
YIRNRYL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgcccacggccgccgcccccatcatcagctcggtccagaagctggttctgtatgagact
agagctagatactttctagttgggagcaataatgcagaaacgaaatatcgtgtcttgaag
attgatagaacagaaccaaaagatttggtcataattgatgacaggcatgtctatactcaa
caagaagtaagggaacttcttggccgcttggatcttggaaatagaacaaagatgggacag
aaaggatcctcgggcttatttcgagcggtttcagcttttggtgttgtgggttttgtcagg
ttcttagaaggctattatattgtgttaataactaaaaggaggaagatggcggatattgga
ggtcatgcaatctataaggtcgaagatacaaatatgatctatatacccaatgattctgta
cgggttactcatcctgatgaagctaggtatctacgaatatttcaaaatgtggacctatct
agcaatttttactttagttacagctatgatttgtcccactcacttcaatataatctcact
gtcttgcgaatgcccctggagatgttaaagtcagaaatgacccagaatcgccaagagagc
tttgacatctttgaagatgaaggattaattacacaaggtggaagcggggtatttgggatc
tgtagtgagccttatatgaaatatgtatggaatggtgaacttctggatataattaaaagt
actgtgcatcgtgactggcttttgtatattattcatgggttctgtgggcagtcaaagctg
ttgatctatggacgaccagtgtatgtcactctaatagctagaagatccagtaaatttgct
ggcacccgttttcttaaaagaggtgcaaactgtgagggtgatgttgcaaatgaagtggag
actgaacaaatactctgcgatgcttctgtgatgtctttcactgcaggaagttattcttca
tatgtacaagttagaggatctgtgcccttatactggtctcaggacatttcaactatgatg
cctaaaccacctattacattggatcaggcagatccatttgcacatgtggctgcccttcac
tttgaccagatgttccagaggtttggctctcccatcatcatcttgaatttagtgaaggaa
cgagagaaaagaaagcatgaaagaattctgagtgaagaacttgttgctgctgtgacctat
ctcaaccaatttttgcctcctgagcacactattgtttatattccctgggacatggccaag
tataccaaaagcaagctgtgtaatgttcttgatcgactaaatgtgattgcagaaagtgtg
gtgaagaaaacaggtttctttgtaaaccgccctgattcttactgtagcattttgcggcca
gatgaaaagtggaatgaactaggaggatgtgtgattcccactggtcgcctgcagactggc
atccttcgaaccaactgtgtggactgtttagatcgcaccaacacagcacagtttatggtg
ggaaaatgtgctctggcctatcagctgtattcactgggactgattgacaaacctaatcta
cagtttgatacagatgcagttaggttatttgaggaactctatgaagatcatggtgatacc
ctatcccttcagtatggtggttctcaacttgttcatcgtgtgaaaacctacagaaagata
gcaccatggacccagcactccaaagacatcatgcaaaccctgtctagatattacagcaat
gctttttcagatgccgatagacaagattccattaatctcttcctgggagttttccatccc
actgaagggaaacctcatctctgggagctcccaacagatttttatttgcatcacaaaaat
accatgagacttttgccaacaagaagaagttatacttactggtggacaccagaggtgata
aagcatttaccattgccctatgatgaagttatctgtgctgtgaacttaaagaagttgata
gtgaagaaattccacaaatatgaagaagagattgatatccacaatgagttctttcggcca
tatgagttgagcagctttgatgataccttttgcttggctatgacaagctcagcacgtgac
tttatgcctaagaccgttggaattgatccaagtccatttactgtgcgtaaaccagatgaa
actggaaaatcagtattgggaaacaaaagcaatagagaagaagctgtattacagcggaaa
acggcagccagcgccccgccgccccccagcgaggaggctgtgtccagcagctctgaggat
gactctgggactgatcgggaagaagagggctctgtgtctcagcgctccactcccgtgaag
atgactgatgcaggagacagtgccaaagtgaccgagaatgtggtccaacccatgaaggag
ctatatggaattaacctctcagatggcctctcagaagaagatttctccatttattcaaga
tttgttcagctggggcagagtcaacataaacaagacaagaatagccagcagccctgttct
aggtgctcagatggagttataaaactaacacccatctcggctttctcgcaagataacatc
tatgaagttcagcccccaagagtagacagaaaatctacagagatcttccaagcccacatc
caggccagccaaggtatcatgcagcccctaggaaaagaggactcctccatgtaccgagag
tacatcaggaaccgctacctgtga

DBGET integrated database retrieval system