KEGG   Homo sapiens (human): 9904Help
Entry
9904              CDS       T01001                                 

Gene name
RBM19
Definition
(RefSeq) RNA binding motif protein 19
  KO
K14787  
multiple RNA-binding domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    9904 (RBM19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.21
AA seq 960 aa AA seqDB search
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQK
HFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKV
AGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGS
EAEEEDSSATPVLQERDSKGAGQEQGMPAGKKRPPEARAETEKPANQKEPTTCHTVKLRG
APFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEK
LFSKYGPLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQVFQGRMLHVLPSTI
KKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLA
AQLQETFGHFGSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPVG
VFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVE
YRKPEQAQKALKQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIP
FQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHL
YGRRLVLEWADSEVTLQALRRKTAAHFHEPPKKKRSVVLDEILEQLEGSDSDSEEQTLQL
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgactgatcgtgaagaatctcccgaatgggatgaaggaggagcgtttcaggcag
ctgtttgccgccttcggcacgctgacagactgcagcctgaagttcaccaaagatggcaag
ttccgcaagtttggttttattggcttcaagtccgaggaagaggcccagaaggcacagaag
catttcaacaagagcttcatcgacacatcccggatcacagtggagttctgcaagtcattc
ggggacccggccaaacccagagcctggagcaaacatgcccagaaaccaagccagcccaag
cagcctccaaaagactctactactccagaaattaagaaagatgagaagaagaaaaaggtg
gcaggtcaactggagaagctgaaggaggatacagagttccaggagtttctgtcagttcat
cagaggcgggcgcaggcagccacttgggcgaatgatggcctggatgctgagccctcgaaa
gggaagagcaagccggccagtgactacctgaacttcgactccgattctgggcaggagagt
gaggaggagggagccggggaggacctggaagaagaggcaagcctcgaaccaaaggcagct
gtgcagaaggagctgtcggacatggattacctgaaatccaagatggtgaaggctgggtcg
tcctcttcctcggaggaagaggaaagtgaagatgaagccgtgcactgtgatgaagggagt
gaggccgaggaagaggattcctccgccaccccagtcctgcaggaaagagacagcaagggt
gcaggccaagagcaagggatgccagctgggaaaaagagaccaccggaggccagagccgag
acagagaaaccagcaaaccagaaggaacccaccacctgccacaccgtgaagctgcgggga
gccccgttcaatgtcacagagaaaaatgttatggaattcctggcacccctgaaaccagtg
gccattcgaattgtgagaaacgctcatgggaataaaacaggatacatctttgtggatttc
agcaatgaagaggaagtgaagcaagctctgaaatgcaaccgggagtacatgggtgggcgc
tacatcgaggtgttcagggaaaagaacgtccccaccaccaagggtgcaccaaagaatacc
accaaatcctggcaaggccggatactcggggagaacgaagaggaggaggacctggccgaa
tccggaaggctctttgtacggaacctgccctacaccagcaccgaggaggatctggagaag
ctcttctccaaatatggtcccctgtctgagctccactaccccatcgacagcctgaccaag
aaacccaagggttttgcattcatcaccttcatgttccctgagcacgctgtgaaggcctac
tcggaggtggacgggcaggtattccagggcaggatgctccacgtgttaccatctaccatc
aagaaggaagccagcgaggatgccagtgccctgggatcgtcgtcctacaagaagaagaag
gaggcccaggacaaagccaacagtgccagctctcacaactggaacacactattcatgggg
ccgaatgccgtggccgatgccatcgcacagaagtacaacgccaccaagagtcaagtgttt
gaccacgagaccaagggcagcgtggccgtgcgcgtggctctgggggaaacccagctcgtc
caggaagtgcggcgttttctcatagacaacggggtcagcctggattccttcagccaggct
gcagcagagcgaagcaagactgtgattctggtcaagaacctcccggcaggcaccctggcg
gcccagctgcaggagaccttcggccattttggcagcctgggccgcgtgctgctgccagag
ggcggaatcactgccatcgtggagttcctggagcccctggaggcccgcaaggccttcagg
catctggcctattccaagttccatcatgtccccctctatctggagtgggctccagttggc
gtcttctccagcacagccccacagaagaaaaagctccaagacacaccttcagaacccatg
gaaaaggacccagcagagccagaaacagtgcctgatggcgaaaccccagaagatgaaaat
ccaacagaggaaggagcagacaactcttcagcaaagatggaagaggaggaggaggaagag
gaagaagaagaagagagcctcccaggatgtactctgtttattaagaatctcaattttgac
acaacagaagagaagctgaaggaagtgttttcaaaagtggggacagtgaagagctgctcc
atctccaagaagaagaacaaagcaggagtgctcctttccatggggtttggatttgtggaa
tacaggaagccggagcaagcccagaaagctctcaagcagctccagggtcacgtcgtggac
ggccacaagctggaagtgaggatctcggaacgagccactaagccagccgtgacattggct
cggaagaaacaagttcccagaaagcagaccacctccaagatcctggtgcggaacatcccc
ttccaggcccacagccgggagatccgagagctcttcagcacctttggggagttgaagacg
gtccgcctgccaaagaagatgactgggacaggcacacacagaggcttcggctttgtggac
ttcctcaccaagcaggatgcgaagagagccttcaacgccctgtgtcacagcacccacttg
tacgggcggaggctggtgctggagtgggccgactccgaggtgaccctgcaggccctgcgg
cggaagacggccgctcactttcacgagcccccgaagaaaaagcggtctgtggtgttggac
gagatcctggagcagctggaaggcagtgacagcgacagcgaggagcagacccttcagctg
tga

DBGET integrated database retrieval system