KEGG   Homo sapiens (human): 9914Help
Entry
9914              CDS       T01001                                 

Gene name
ATP2C2, SPCA2
Definition
(RefSeq) ATPase secretory pathway Ca2+ transporting 2 (EC:3.6.3.8)
  KO
K01537  
Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     9914 (ATP2C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.1
AA seq 946 aa AA seqDB search
MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKC
QKEDLARAFCVDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLG
SALVSVLTKEYEDAVSIATAVLVVVTVAFIQEYRSEKSLEELTKLVPPECNCLREGKLQH
LLARELVPGDVVSLSIGDRIPADIRLTEVTDLLVDESSFTGEAEPCSKTDSPLTGGGDLT
TLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAEETPKTPLQKSMDRLGKQLTL
FSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLGVLRMAKKRVI
VKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRK
KEIPFSSEQKWMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFC
LQEEKRMGSLGLRVLALASGPELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMIT
GDALETALAIGRNIGLCNGKLQAMSGEEVDSVEKGELADRVGKVSVFFRTSPKHKLKIIK
ALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSKEAANMILVDDDFSAIMNAVE
EGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINIIMDGPPAQSLG
VEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQ
TENLGALDLLFLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagggacgcgtctccgagttcctgaagaaactcggcttctcgggcgggggccgc
cagtaccaggcgctggagaaggacgaagaggaagccttgattgatgaacagagtgagctg
aaagccatcgagaaagagaagaaggtgacagccctgccccccaaggaagcgtgcaaatgc
cagaaagaggatttggccagagcgttttgtgtggacttacacactgggctgtcggagttc
tcggtgacgcagcgccggctggcccatggctggaatgagtttgttgctgacaacagcgaa
cctgtgtggaagaaatacctggatcagtttaagaaccccctgatcctgctgctgctgggc
tctgccctggtgagtgtcctcaccaaggagtatgaggacgccgtcagcatcgccacggca
gtgcttgtcgtggtcactgtcgccttcatccaggagtacaggtcggagaaatctctggaa
gagctgaccaagctggttcctccagaatgtaactgcctaagagaaggaaaactccagcac
ctgcttgctcgagaactggttcctggtgatgtcgtatctctctcgatcggagaccggatc
cctgcagacatccgactcactgaggtcacggacctcttggtggatgaatccagtttcacc
ggggaagccgagccatgtagtaaaacagacagccccttgacaggcggtggggacctcacc
accctcagcaacatcgtcttcatggggaccctggtgcagtatgggaggggccagggggtc
gtgattggaacaggggaaagctctcagttcggagaagtgtttaagatgatgcaggctgaa
gagacacctaaaactcctttgcagaaaagcatggacaggctaggaaagcaactgacactc
ttctcctttggcataatcggtctcatcatgctcattggctggtcgcaagggaaacaactc
ctgagtatgttcacgatcggggtcagcctggctgtggcggccattccagagggtctgccc
atcgtcgtcatggtgacgctggtcctgggagtgctgcggatggccaagaagcgggtcatc
gtgaagaagttacccatcgtggagactttaggttgctgcagcgttctctgttctgacaag
acggggactctgactgccaatgaaatgacagtgacccagcttgtaacgtcagatgggctt
cgtgccgaggtcagcggagttgggtatgacggtcaagggactgtgtgtcttctaccatcc
aaggaagtcattaaggaattttccaatgtctcagtgggaaagttagtggaggcgggctgt
gttgccaacaatgcggtcatcagaaagaacgccgtgatggggcagcccaccgagggtgca
ttgatggccctggcgatgaagatggacttaagtgatattaaaaattcatatataagaaaa
aaagagattccattcagttcagagcagaagtggatggcggtgaaatgcagtctgaagact
gaggatcaggaagacatttacttcatgaaaggggccttggaagaggtgatccgctactgc
accatgtacaacaacgggggcatccccctgccgctgacgccccagcagaggtcattctgc
ctgcaggaagagaagaggatggggtcgctcggtttgcgggtgctggccctggcttctggg
cccgagctggggcggctgacgtttctcggtcttgtgggcatcattgaccccccgagagtt
ggcgtgaaggaagcagtccaggttctctccgagtctggtgtgtctgtgaagatgataacg
ggggatgccctggagacggccttggccataggaagaaacatcggcctgtgcaacgggaag
ctgcaagccatgtccggggaggaggtggacagcgtggagaagggcgagctggccgaccgc
gtggggaaggtgtccgtgttcttcaggaccagcccaaagcacaagctcaaaatcatcaag
gctctgcaggagtcaggggcgatcgtggccatgactggggatggggtgaacgacgcagtg
gccctgaagtctgcagacattgggatcgccatggggcagacagggacggacgtcagcaaa
gaggccgccaacatgatcctggtggatgatgacttctcagccatcatgaatgcagtggag
gaaggcaagggtattttttacaacatcaaaaactttgtccgattccagctgagcacgagc
atctccgccctgagtctcatcactctgtccaccgtgttcaacctgcccagccccctcaac
gccatgcagatcctatggatcaacatcatcatggatgggccaccggcgcagagcttgggg
gtagagcccgttgacaaagacgccttcaggcagccaccacggagtgtgcgggacaccatc
ctcagcagagccctcatcctgaagatcctcatgtccgcggccatcatcatcagcgggacc
ctctttatcttctggaaggagatgcctgaagacagagcaagcactccccgcaccacgacg
atgacgttcacttgttttgtgtttttcgatctcttcaacgccttgacctgccgctctcag
accaagctgatatttgagatcggctttctcaggaaccacatgttcctctactccgtcctg
gggtccatcctggggcagctggcggtcatttacatccccccgctgcagagggtcttccag
acggagaacctgggagcgcttgatttgctgtttttaactggattggcctcatccgtcttc
attttgtcagagctcctcaaactatgtgaaaaatactgttgcagccccaagagagtccag
atgcaccctgaagatgtgtag

DBGET integrated database retrieval system