KEGG   Homo sapiens (human): 9927Help
Entry
9927              CDS       T01001                                 

Gene name
MFN2, CMT2A, CMT2A2, CPRP1, HMSN6A, HSG, MARF
Definition
(RefSeq) mitofusin 2
  KO
K06030  
mitofusin [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     9927 (MFN2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    9927 (MFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.22
AA seq 757 aa AA seqDB search
MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDT
YRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK
VLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVS
VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHF
FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDR
IFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ
HTVRAKQIAEAVRLIMDSLHMAAREQQVYCEEMREERQDRLKFIDKQLELLAQDYKLRIK
QITEEVERQVSTAMAEEIRRLSVLVDDYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD
RCSTAITNSLQTMQQDMIDGLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQED
IEFHFSLGWTMLVNRFLGPKNSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFM
VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERA
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKK
IEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctcttctctcgatgcaactctatcgtcacagtcaagaaaaataagagacac
atggctgaggtgaatgcatccccacttaagcactttgtcactgccaagaagaagatcaat
ggcatttttgagcagctgggggcctacatccaggagagcgccaccttccttgaagacacg
tacaggaatgcagaactggaccccgttaccacagaagaacaggttctggacgtcaaaggt
tacctatccaaagtgagaggcatcagtgaggtgctggctcggaggcacatgaaagtggct
ttttttggccggacgagcaatgggaagagcaccgtgatcaatgccatgctctgggacaaa
gttctgccctctgggattggccacaccaccaattgcttcctgcgggtagagggcacagat
ggccatgaggcctttctccttaccgagggctcagaggaaaagaggagtgccaagactgtg
aaccagctggcccatgccctccaccaggacaagcagctccatgccggcagcctagtgagt
gtgatgtggcccaactctaagtgcccacttctgaaggatgacctcgttttgatggacagc
cctggtattgatgtcaccacagagctggacagctggattgacaagttttgtctggatgct
gatgtgtttgtgctggtggccaactcagagtccaccctgatgcagacggaaaagcacttc
ttccacaaggtgagtgagcgtctctcccggccaaacatcttcatcctgaacaaccgctgg
gatgcatctgcctcagagcccgagtacatggaggaggtgcggcggcagcacatggagcgt
tgtaccagcttcctggtggatgagctgggcgtggtggatcgatcccaggccggggaccgc
atcttctttgtgtctgctaaggaggtgctcaacgccaggattcagaaagcccagggcatg
cctgaaggagggggcgctctcgcagaaggctttcaagtgaggatgtttgagtttcagaat
tttgagaggagatttgaggagtgcatctcccagtctgcagtgaagaccaagtttgagcag
cacacggtccgggccaagcagattgcagaggcggttcgactcatcatggactccctgcac
atggcggctcgggagcagcaggtttactgcgaggaaatgcgtgaagagcggcaagaccga
ctgaaatttattgacaaacagctggagctcttggctcaagactataagctgcgaattaag
cagattacggaggaagtggagaggcaggtgtcgactgcaatggccgaggagatcaggcgc
ctctctgtactggtggacgattaccagatggacttccacccttctccagtagtcctcaag
gtttataagaatgagctgcaccgccacatagaggaaggactgggtcgaaacatgtctgac
cgctgctccacggccatcaccaactccctgcagaccatgcagcaggacatgatagatggc
ttgaaacccctccttcctgtgtctgtgcggagtcagatagacatgctggtcccacgccag
tgcttctccctcaactatgacctaaactgtgacaagctgtgtgctgacttccaggaagac
attgagttccatttctctctcggatggaccatgctggtgaataggttcctgggccccaag
aacagccgtcgggccttgatgggctacaatgaccaggtccagcgtcccatccctctgacg
ccagccaaccccagcatgcccccactgccacagggctcgctcacccaggaggagttcatg
gtttccatggttaccggcctggcctccttgacatccaggacctccatgggcattcttgtt
gttggaggagtggtgtggaaggcagtgggctggcggctcattgccctctcctttgggctc
tatggcctcctctacgtctatgagcgtctgacctggaccaccaaggccaaggagagggcc
ttcaagcgccagtttgtggagcatgccagcgagaagctgcagcttgtcatcagctacact
ggctccaactgcagccaccaagtccagcaggaactgtctgggacctttgctcatctgtgt
cagcaagttgacgtcacccgggagaacctggagcaggaaattgccgccatgaacaagaaa
attgaggttcttgactcacttcagagcaaagcaaagctgctcaggaataaagccggttgg
ttggacagtgagctcaacatgttcacacaccagtacctgcagcccagcagatag

DBGET integrated database retrieval system