KEGG   Homo sapiens (human): 993Help
Entry
993               CDS       T01001                                 

Gene name
CDC25A, CDC25A2
Definition
cell division cycle 25A (EC:3.1.3.48)
Orthology
K06645  
M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Progesterone-mediated oocyte maturation
MicroRNAs in cancer
Module
DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    993 (CDC25A)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    993 (CDC25A)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    993 (CDC25A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     993 (CDC25A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21
AA seq 524 aa AA seqDB search
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggcccggagcccccgcaccgccgccgcctgctcttcgcctgcagcccccct
cccgcgtcgcagcccgtcgtgaaggcgctatttggcgcttcagccgccgggggactgtcg
cctgtcaccaacctgaccgtcactatggaccagctgcagggtctgggcagtgattatgag
caaccactggaggtgaagaacaacagtaatctgcagagaatgggctcctccgagtcaaca
gattcaggtttctgtctagattctcctgggccattggacagtaaagaaaaccttgaaaat
cctatgagaagaatacattccctacctcagaagctgttgggatgtagtccagctctgaag
aggagccattctgattctcttgaccatgacatctttcagctcatcgacccagatgagaac
aaggaaaatgaagcctttgagtttaagaagccagtaagacctgtatctcgtggctgcctg
cactctcatggactccaggagggtaaagatctcttcacacagaggcagaactctgcccca
gctcggatgctttcctcaaatgaaagagatagcagtgaaccagggaatttcattcctctt
tttacaccccagtcacctgtgacagccactttgtctgatgaggatgatggcttcgtggac
cttctcgatggagagaatctgaagaatgaggaggagaccccctcgtgcatggcaagcctc
tggacagctcctctcgtcatgagaactacaaaccttgacaaccgatgcaagctgtttgac
tccccttccctgtgtagctccagcactcggtcagtgttgaagagaccagaacgatctcaa
gaggagtctccacctggaagtacaaagaggaggaagagcatgtctggggccagccccaaa
gagtcaactaatccagagaaggcccatgagactcttcatcagtctttatccctggcatct
tcccccaaaggaaccattgagaacattttggacaatgacccaagggaccttataggagac
ttctccaagggttatctctttcatacagttgctgggaaacatcaggatttaaaatacatc
tctccagaaattatggcatctgttttgaatggcaagtttgccaacctcattaaagagttt
gttatcatcgactgtcgatacccatatgaatacgagggaggccacatcaagggtgcagtg
aacttgcacatggaagaagaggttgaagacttcttattgaagaagcccattgtacctact
gatggcaagcgtgtcattgttgtgtttcactgcgagttttcttctgagagaggtccccgc
atgtgccggtatgtgagagagagagatcgcctgggtaatgaataccccaaactccactac
cctgagctgtatgtcctgaaggggggatacaaggagttctttatgaaatgccagtcttac
tgtgagccccctagctaccggcccatgcaccacgaggactttaaagaagacctgaagaag
ttccgcaccaagagccggacctgggcaggggagaagagcaagagggagatgtacagtcgt
ctgaagaagctctga

DBGET integrated database retrieval system