KEGG   Homo sapiens (human): 9934Help
Entry
9934              CDS       T01001                                 

Gene name
P2RY14, BPR105, GPR105, P2Y14
Definition
(RefSeq) purinergic receptor P2Y14
  KO
K04299  
purinergic receptor P2Y, G protein-coupled, 14
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9934 (P2RY14)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    9934 (P2RY14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24-q25.1
AA seq 338 aa AA seqDB search
MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcaacctccacacagcctccagatgaatcctgctctcagaacctcctgatc
actcagcagatcattcctgtgctgtactgtatggtcttcattgcaggaatcctactcaat
ggagtgtcaggatggatattcttttacgtgcccagctctaagagtttcatcatctatctc
aagaacattgttattgctgactttgtgatgagcctgacttttcctttcaagatccttggt
gactcaggccttggtccctggcagctgaacgtgtttgtgtgcagggtctctgccgtgctc
ttctacgtcaacatgtacgtcagcattgtgttctttgggctcatcagctttgacagatat
tataaaattgtaaagcctctttggacttctttcatccagtcagtgagttacagcaaactt
ctgtcagtgatagtatggatgctcatgctcctccttgctgttccaaatattattctcacc
aaccagagtgttagggaggttacacaaataaaatgtatagaactgaaaagtgaactggga
cggaagtggcacaaagcatcaaactacatcttcgtggccatcttctggattgtgtttctt
ttgttaatcgttttctatactgctatcacaaagaaaatctttaagtcccaccttaagtca
agtcggaattccacttcggtcaaaaagaaatctagccgcaacatattcagcatcgtgttt
gtgttttttgtctgttttgtaccttaccatattgccagaatcccctacacaaagagtcag
accgaagctcattacagctgccagtcaaaagaaatcttgcggtatatgaaagaattcact
ctgctactatctgctgcaaatgtatgcttggaccctattatttatttctttctatgccag
ccgtttagggaaatcttatgtaagaaattgcacattccattaaaagctcagaatgaccta
gacatttccagaatcaaaagaggaaatacaacacttgaaagcacagatactttgtga

DBGET integrated database retrieval system