KEGG   Homo sapiens (human): 9942Help
Entry
9942              CDS       T01001                                 

Gene name
XYLB
Definition
xylulokinase homolog (H. influenzae) (EC:2.7.1.17)
Orthology
K00854  
xylulokinase [EC:2.7.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    9942 (XYLB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     9942 (XYLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22-p21.3
AA seq 536 aa AA seqDB search
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcacgcccctcgccgctgctgcctgggctgggacttcagcacgcagcaggta
aaggttgttgctgttgatgcagagttgaatgtcttctatgaggaaagtgtgcattttgac
agagatcttccagaatttgggactcagggcggtgttcatgtgcacaaggatgggctgacg
gtcacttctccagtactaatgtgggtccaggcactggatatcatcttggagaagatgaag
gcttcgggcttcgacttctctcaagtcctagccttgtccggggcgggccagcaacacgga
agtatatactggaaggctggagcccagcaggcactgacaagcttatcaccagacctccgg
ctacaccagcagctgcaggactgtttctccatcagcgactgcccggtgtggatggactcc
agcaccacagcccagtgccgccagctggaggctgctgtgggtggtgctcaggctctcagc
tgcctcacggggtcccgtgcctatgagcgttttacagggaaccaaattgcaaaaatttac
cagcagaaccccgaggcctactcacatacggagagaatttctttggtcagtagctttgct
gcttccctgttccttggctcttactcccctattgactacagtgatggttctggaatgaat
ttgttgcagatacaggataaagtctggtcccaggcttgccttggtgcctgtgcacctcat
ttagaggagaagcttagcccaccagtaccatcatgctcagttgtgggagccatttcttcc
tactacgtccagcgctacggatttcctccaggatgcaaagtggtggccttcactggggac
aacccagcgtcgctggcaggcatgagactggaggaaggtgacattgcggtcagcctgggc
accagtgacaccctgtttctctggctccaagagcccatgcctgccctggaaggccacatc
ttctgcaacccggttgactcccagcactacatggcactcctgtgctttaaaaatggctcc
ctcatgagagagaagatccgcaacgagtctgtatcccgttcctggagcgatttctctaag
gcactgcagtccacagagatgggcaacggtggaaacctgggtttttattttgatgtaatg
gagatcacccctgaaattattggacgtcataggtttaacacagaaaaccacaaggttgca
gcattccctggggatgtggaggttcgagcactaattgaaggacaattcatggccaagagg
attcacgcagaaggcctgggctatcgagtcatgtccaagacaaagattttggccacagga
ggagcatctcacaatagagaaatcttacaggtgcttgcagatgtgtttgatgccccggtg
tatgttatagacactgccaactcggcctgtgtgggttctgcataccgagcttttcatggt
cttgcaggtggaacagatgtgcccttttcagaggttgtgaagttagctccaaatcccaga
ctagctgctaccccaagcccgggagcttctcaggtctacgaggcccttctcccccagtat
gccaaactcgagcagagaatcttgtctcagacccgggggcctccggagtga

DBGET integrated database retrieval system