KEGG   Homo sapiens (human): 9953Help
Entry
9953              CDS       T01001                                 

Gene name
HS3ST3B1, 3-OST-3B, 3OST3B1, h3-OST-3B
Definition
(RefSeq) heparan sulfate-glucosamine 3-sulfotransferase 3B1
  KO
K07809  
[heparan sulfate]-glucosamine 3-sulfotransferase 3 [EC:2.8.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    9953 (HS3ST3B1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.30  [heparan sulfate]-glucosamine 3-sulfotransferase 3
     9953 (HS3ST3B1)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   9953 (HS3ST3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y662(Tdark)
UniProt: 
Position
17p12
AA seq 390 aa AA seqDB search
MGQRLSGGRSCLDVPGRLLPQPPPPPPPVRRKLALLFAMLCVWLYMFLYSCAGSCAAAPG
LLLLGSGSRAAHDPPALATAPDGTPPRLPFRAPPATPLASGKEMAEGAASPEEQSPEVPD
SPSPISSFFSGSGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKG
LAWYRDLMPRTLDGQITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQ
TLSKRPDIPTFESLTFKNRTAGLIDTSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERL
ISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEI
DREVVRRLREFYRPFNLKFYQMTGHDFGWD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgcctgagtggcggcagatcttgcctcgatgtccccggccggctcctaccg
cagccgccgccgcccccgccgccggtgaggaggaagctcgcgctgctcttcgccatgctc
tgcgtctggctctatatgttcctgtactcgtgcgccggctcctgcgccgccgcgccgggg
ctgctgctcctgggctctgggtcccgcgccgcacacgacccgccagccctggccacagct
ccggacgggacgccccccaggctgccgttccgggcgccgccagccaccccactggcttca
ggcaaggagatggccgagggcgctgcgagcccggaggagcagagtcccgaggtgccggac
tccccaagccccatctccagctttttcagtgggtctgggagcaagcagctgccgcaggcc
atcatcatcggcgtgaagaagggcggcacgcgggcgctgctggagtttctgcgcgtgcac
cccgacgtgcgcgccgtgggcgccgagccccatttcttcgatcgcagctacgacaagggc
ctcgcttggtaccgggacctgatgcccagaaccctggacgggcagatcaccatggagaag
acgcccagttacttcgtcacgcgggaggcccctgcgcgcatctcggccatgtccaaggac
accaagctcatcgtggtggtgcgggacccggtgaccagggccatctcggactacacgcag
acgctgtccaagcggcccgacatccccaccttcgagagcttgacgttcaaaaacaggaca
gcgggcctcatcgacacgtcgtggagcgccatccagatcggcatctacgccaagcacctg
gagcactggctgcgccacttccccatccgccagatgctcttcgtgagcggcgagcggctc
atcagcgacccggccggggagctgggccgcgtgcaagacttcctgggcctcaagaggatc
atcacggacaagcacttctacttcaacaagaccaagggcttcccctgcctgaagaaggcg
gagggcagcagccggccccattgcctgggcaagaccaagggcaggacccatcctgagatc
gaccgcgaggtggtgcgcaggctgcgcgagttctaccggcctttcaacctcaagttctac
cagatgaccgggcacgactttggctgggattga

DBGET integrated database retrieval system