KEGG   Homo sapiens (human): 9956Help
Entry
9956              CDS       T01001                                 

Gene name
HS3ST2, 30ST2, 3OST2
Definition
heparan sulfate (glucosamine) 3-O-sulfotransferase 2 (EC:2.8.2.29)
Orthology
K07808  
[heparan sulfate]-glucosamine 3-sulfotransferase 2 [EC:2.8.2.29]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12
AA seq 367 aa AA seqDB search
MAYRVLGRAGPPQPRRARRLLFAFTLSLSCTYLCYSFLCCCDDLGRSRLLGAPRCLRGPS
AGGQKLLQKSRPCDPSGPTPSEPSAPSAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIV
GVKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGRGLDWYRSLMPRTLESQITLEKTPS
YFVTQEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLSKKPDIPTFEGLSFRNRTLGL
VDVSWNAIRIGMYVLHLESWLQYFPLAQIHFVSGERLITDPAGEMGRVQDFLGIKRFITD
KHFYFNKTKGFPCLKKTESSLLPRCLGKSKGRTHVQIDPEVIDQLREFYRPYNIKFYETV
GQDFRWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcctatagggtcctgggccgcgcggggccacctcagccgcggagggcgcgcaggctg
ctcttcgccttcacgctctcgctctcctgcacttacctgtgttacagcttcctgtgctgc
tgcgacgacctgggtcggagccgcctcctcggcgcgcctcgctgcctccgcggccccagc
gcgggcggccagaaacttctccagaagtcccgcccctgtgatccctccgggccgacgccc
agcgagcccagcgctcccagcgcgcccgccgccgccgtgcccgcccctcgcctctccggt
tccaaccactccggctcacccaagctgggtaccaagcggttgccccaagccctcattgtg
ggcgtgaagaaggggggcacccgggccgtgctggagtttatccgagtacacccggacgtg
cgggccttgggcacggaaccccacttctttgacaggaactacggccgcgggctggattgg
tacaggagcctgatgcccaggaccctcgagagccagatcacgctggagaagacgcccagc
tactttgtcactcaagaggctcctcgacgcatcttcaacatgtcccgagacaccaagctg
atcgtggttgtgcggaaccctgtgacccgtgccatctctgattacacgcagacactctcc
aagaagcccgacatcccgacctttgagggcctctccttccgcaaccgcaccctgggcctg
gtggacgtgtcatggaacgccatccgcatcggcatgtacgtgctgcacctggagagctgg
ctgcagtacttcccgctagctcagattcacttcgtcagtggcgagcgactcatcactgac
ccggccggcgagatggggcgagtccaggacttcctgggcattaagagattcatcacggac
aagcacttctatttcaacaagaccaaaggattcccttgcttgaaaaaaacagaatcgagc
ctcctgcctcgatgcttgggcaaatcaaaagggagaactcatgtacagattgatcctgaa
gtgatagaccagctccgagaattttatagaccgtataatatcaaattttatgaaaccgtt
gggcaggacttcaggtgggaataa

DBGET integrated database retrieval system