KEGG   Homo sapiens (human): 9958Help
Entry
9958              CDS       T01001                                 

Gene name
USP15, UNPH-2, UNPH4
Definition
ubiquitin specific peptidase 15 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14
AA seq 981 aa AA seqDB search
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYL
VRMDPLTKPMQYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENL
SSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRN
NTEDKLYNLLLLRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQLTGHKKRLFTFQFNNLG
NTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKP
PKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLE
SDEDSNDNDNDIENENCMHTN
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagcggcggatctggacacccagcggtctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtacctagtcgatagtcgctggttcaaacag
tggaaaaaatatgttggctttgacagttgggacaaataccagatgggagatcaaaatgtg
tatcctggacccattgataactctggacttctcaaagatggtgatgcccagtcacttaag
gaacaccttattgatgaattggattacatactgttgccaactgaaggttggaataaactt
gtcagctggtacacattgatggaaggtcaagagccaatagcacgaaaggtggttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctcacagaattgaagctatgtgaa
aatggaaacatgaataatgttgtaactcgaagatttagcaaagctgacacaatagataca
attgaaaaggaaataagaaaaatcttcagtattccagatgaaaaggagaccagattgtgg
aacaaatacatgagtaacacatttgaaccactgaataaaccagacagcaccattcaggat
gctggtttataccaaggacaggtattagtgatagaacagaaaaatgaagatggaacatgg
ccaaggggtccttctactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccttcatctctatcaaataattataacaacatgaacaacagaaatgtgaaaaac
tcaaattactgtcttccatcatataccgcttataagaactatgattattcggaacctgga
agaaacaatgaacagccaggcctctgtggcctaagtaacttgggaaatacgtgtttcatg
aactcagctattcagtgtttgagcaacacacctccacttactgagtatttcctcaatgat
aagtatcaagaagaactgaattttgacaatcccttaggaatgagaggtgaaatagctaaa
tcttatgccgaactgatcaagcaaatgtggtctggaaagtttagctacgtcaccccaaga
gcctttaagacacaggtaggacgttttgcacctcagttctctggatatcagcagcaagac
tgtcaagaactgttagctttcctattagatggattacatgaggatttgaatagaattagg
aaaaaaccatatatacaattaaaagatgcagatggaaggccagataaggtggttgccgaa
gaagcctgggaaaaccatttaaaacgaaatgattctatcatagtagatatatttcatggc
cttttcaaatcaactttagtttgtcctgagtgtgctaagatttcagtaacatttgatcct
ttttgttacttgacacttccattgcccatgaaaaaagaacgcaccttggaagtttactta
gttagaatggatccacttaccaaacctatgcagtacaaagtggttgtccccaaaattgga
aacatattagatctttgtacagcattgtctgctttgtcaggaatacctgcagataagatg
atagttactgatatatacaatcatagatttcacagaatattcgctatggatgaaaacctt
agtagtattatggaacgggatgatatttatgtgtttgaaattaacatcaataggacagaa
gatacagagcacgtgattattcctgtttgcctaagagaaaaattcagacactcgagttat
acccaccatactggttcttcactttttggtcagccctttcttatggctgtaccacgaaac
aatactgaagacaaactttataatctcctgctcttgagaatgtgccgatatgtcaaaata
tctactgaaactgaagaaactgaaggatccctacactgctgtaaggaccaaaatattaat
gggaatggcccaaatggcatacatgaagaaggctcaccaagtgaaatggaaacagatgag
ccagatgatgaatccagccaggatcaagaacttccctcagagaatgaaaacagtcagtct
gaagattcagttggaggagataatgattctgaaaatggattatgtactgaggatacttgc
aaaggtcaactcacgggacacaaaaaacgattgtttacattccagttcaacaacttaggc
aatactgatatcaactacatcaaagatgataccaggcatataagatttgatgataggcag
cttaggctagatgaaagatcttttcttgctttggattgggatcctgatttgaaaaaaaga
tattttgatgaaaatgctgctgaggactttgaaaaacatgaaagtgtggagtataaacct
cctaaaaaaccctttgtgaaattaaaagattgcattgaactttttacaacaaaagaaaag
ctaggtgctgaagatccctggtattgtccgaattgtaaagaacatcagcaagccacaaag
aaattggatttatggtccctgcctccagtacttgtagtacatctcaagcgattttcttac
agtcgatacatgagagacaagttggataccttagttgattttcctatcaatgacttggat
atgtcggaattcttaattaatccaaatgcaggtccttgccgctataatctgattgctgtt
tccaaccactatggagggatgggaggaggacactatactgcttttgcaaaaaataaagat
gatggaaaatggtactattttgatgacagtagtgtctccactgcatctgaagaccaaatt
gtgtccaaagcagcatatgtactcttctaccagagacaagacactttcagtggaactggc
ttttttcctcttgaccgagaaactaaaggtgcttcagctgccactggcatcccattagaa
agtgatgaagatagcaatgataatgacaatgatatagaaaatgaaaactgtatgcacact
aactaa

DBGET integrated database retrieval system