KEGG   Homo sapiens (human): 9960Help
Entry
9960              CDS       T01001                                 

Gene name
USP3, SIH003, UBP
Definition
ubiquitin specific peptidase 3 (EC:3.4.19.12)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     9960 (USP3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   9960 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
15q22.3
AA seq 476 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGSYRCDDFVVN
DTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNL
GNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRK
TLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVS
RSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDI
PSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLP
KVLCLHLKRFHWTAYLRNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHG
SGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccacacctgagctccagcgtctgcattgctccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgccggtccaacaaaagcccttgggtc
tgtttgacttgttcaagtgtccactgtggaagttatcgctgtgatgattttgtggttaat
gacaccaagctgggactggtacagaaagtcagagaacacttacagaacttggaaaactca
gctttcacagctgacaggcataagaaaagaaaacttttggaaaactcaacactaaacagc
aagttattaaaagtaaatggaagcaccactgccatttgtgccacaggccttcggaatttg
gggaacacatgtttcatgaatgccatccttcagtcactcagtaacattgagcagttttgc
tgttatttcaaagaactgcccgccgtggagttaaggaatgggaaaacagcaggaaggcgg
acataccacaccaggagccaaggggataacaatgtgtctttggtagaagagtttagaaag
acactctgtgctttatggcaaggcagccagactgcatttagcccagagtccttattttat
gttgtttggaagattatgccaaactttaggggctatcaacagcaggacgcccatgaattc
atgcgctaccttttggaccacctacacttggaacttcagggcggtttcaacggtgtttcc
cgctcagcaattctgcaggagaattctactctgtctgcaagtaacaagtgttgcataaat
ggagcatctactgttgtcacggctatattcggaggcattctccaaaatgaggttaactgc
ctcatatgtgggacagaatctagaaagtttgatccattcctagacctttcattagatatt
ccaagtcagttcagaagtaagcgctctaagaatcaagaaaatggaccagtttgttcgtta
cgagattgtcttcgcagttttaccgacttagaagaacttgatgagacagagttatatatg
tgccataaatgcaaaaagaaacaaaagtccacaaaaaagttttggattcaaaaactaccc
aaggtgctatgcttacatttgaaaagatttcattggacagcatatttaagaaataaagtt
gatacatacgtagaatttccactgagaggcctagacatgaaatgctacttactagagcct
gagaacagtggcccggagagctgcctgtatgacctcgccgctgtggtggtgcaccatggt
tccggggttggttctggacattacacagcatacgcaactcacgaaggccgctggttccac
ttcaatgacagtactgtaacactgactgacgaggagactgtggtgaaggcgaaggcctac
atccttttctacgtggaacaccaggccaaagctggatcggataaactttaa

DBGET integrated database retrieval system