KEGG   Homo sapiens (human): 9963Help
Entry
9963              CDS       T01001                                 

Gene name
SLC23A1, SLC23A2, SVCT1, YSPL3
Definition
solute carrier family 23 (ascorbic acid transporter), member 1
Orthology
K14611  
solute carrier family 23 (nucleobase transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Class
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.2
AA seq 598 aa AA seqDB search
MRAQEDLEGRTQHETTRDPSTPLPTEPKFDMLYKIEDVPPWYLCILLGFQHYLTCFSGTI
AVPFLLAEALCVGHDQHMVSQLIGTIFTCVGITTLIQTTVGIRLPLFQASAFAFLVPAKA
ILALERWKCPPEEEIYGNWSLPLNTSHIWHPRIREVQGAIMVSSVVEVVIGLLGLPGALL
NYIGPLTVTPTVSLIGLSVFQAAGDRAGSHWGISACSILLIILFSQYLRNLTFLLPVYRW
GKGLTLLRIQIFKMFPIMLAIMTVWLLCYVLTLTDVLPTDPKAYGFQARTDARGDIMAIA
PWIRIPYPCQWGLPTVTAAAVLGMFSATLAGIIESIGDYYACARLAGAPPPPVHAINRGI
FTEGICCIIAGLLGTGNGSTSSSPNIGVLGITKVGSRRVVQYGAAIMLVLGTIGKFTALF
ASLPDPILGGMFCTLFGMITAVGLSNLQFVDMNSSRNLFVLGFSMFFGLTLPNYLESNPG
AINTGILEVDQILIVLLTTEMFVGGCLAFILDNTVPGSPEERGLIQWKAGAHANSDMSSS
LKSYDFPIGMGIVKRITFLKYIPICPVFKGFSSSSKDQIAIPEDTPENTETASVCTKV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagggcccaggaggacctcgagggccggacacagcatgaaaccaccagggacccctcg
accccgctacccacagagcctaagtttgacatgttgtacaagatcgaggacgtgccacct
tggtacctgtgcatcctgctgggcttccagcactacctgacatgcttcagtggtaccatc
gccgtgcccttcctgctggctgaggcgctgtgtgtgggccacgaccagcacatggttagt
cagctcatcggcaccatcttcacgtgcgtgggcatcaccactctcatccagaccaccgtg
ggcatccggctgccgctgttccaggccagtgcctttgcatttctggttccagccaaagcc
atactggctctggagagatggaaatgccccccggaagaggagatctacggtaactggagt
ctgcccctgaacacctctcatatttggcacccacggatacgggaggtccagggtgcaatc
atggtgtccagcgtggtggaggtggtgattggcctgctggggctgcctggggccctgctc
aactacattgggcctctcacagtcacccccactgtctccctcattggcctttctgtcttc
caagctgctggcgaccgagctggctcccactggggcatctcagcttgctccattctcctg
atcatcctcttctcccagtacctgcgcaacctcaccttcctgctgcctgtctaccgctgg
ggcaagggcctcactctcctccgcatccagatcttcaaaatgtttcctatcatgctggcc
atcatgaccgtgtggctgctctgctatgtcctgaccttgacagacgtgctgcccacagac
ccaaaagcctatggcttccaggcacgaaccgatgcccgtggtgacatcatggctattgca
ccctggatccgcatcccctacccctgtcagtggggcctgcccacggtgactgcggctgct
gtcctgggaatgttcagcgccactctggcaggcatcattgagtccatcggagattactac
gcctgtgcccgcctggctggtgcaccaccccctccagtacatgctatcaacaggggcatc
ttcaccgaaggcatttgctgcatcatcgcggggctattgggcacgggcaacgggtccacc
tcgtccagtcccaacattggcgtcctgggaattaccaaggtgggcagccggcgcgtggtg
cagtatggtgcggctatcatgctggtcctgggcaccatcggcaagttcacggccctcttc
gcctcgctccctgaccccatcctggggggcatgttctgcactctctttggcatgattaca
gctgtggggctgtccaacctgcaatttgtggacatgaactcctctcgcaacctcttcgtg
ctgggattttccatgttcttcgggctcacgctgcccaattacctggagtccaaccctggc
gccatcaatacaggcattcttgaagtggatcagattctgattgtgctgctgaccacggag
atgtttgtgggcgggtgccttgctttcatacttgacaacacagtgccagggagcccagag
gagcgtggtctgatacagtggaaagctggggctcatgccaacagtgacatgtcttccagc
ctcaagagctacgatttccccattgggatgggcatagtaaaaagaattacctttctgaaa
tacattcctatctgcccagtcttcaaaggattttcttcaagttcaaaagatcagattgca
attccagaagacactccagaaaatacagaaactgcatctgtgtgcaccaaggtctga

DBGET integrated database retrieval system