KEGG   Homo sapiens (human): 9966Help
Entry
9966              CDS       T01001                                 

Gene name
TNFSF15, TL1, TL1A, TNLG1B, VEGI, VEGI192A
Definition
(RefSeq) tumor necrosis factor superfamily member 15
  KO
K05478  
tumor necrosis factor ligand superfamily member 15
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00286  
Crohn's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9966 (TNFSF15)
Cytokines [BR:hsa04052]
 TNF family
  9966 (TNFSF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q32
AA seq 251 aa AA seqDB search
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLR
AQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWE
HELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVV
ITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK
EDKTFFGAFLL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctgggactgagctttggggaaacagccagtgtggaaatgctgccagag
cacggcagctgcaggcccaaggccaggagcagcagcgcacgctgggctctcacctgctgc
ctggtgttgctccccttccttgcaggactcaccacatacctgcttgtcagccagctccgg
gcccagggagaggcctgtgtgcagttccaggctctaaaaggacaggagtttgcaccttca
catcagcaagtttatgcacctcttagagcagacggagataagccaagggcacacctgaca
gttgtgagacaaactcccacacagcactttaaaaatcagttcccagctctgcactgggaa
catgaactaggcctggccttcaccaagaaccgaatgaactataccaacaaattcctgctg
atcccagagtcgggagactacttcatttactcccaggtcacattccgtgggatgacctct
gagtgcagtgaaatcagacaagcaggccgaccaaacaagccagactccatcactgtggtc
atcaccaaggtaacagacagctaccctgagccaacccagctcctcatggggaccaagtct
gtatgcgaagtaggtagcaactggttccagcccatctacctcggagccatgttctccttg
caagaaggggacaagctaatggtgaacgtcagtgacatctctttggtggattacacaaaa
gaagataaaaccttctttggagccttcttactatag

DBGET integrated database retrieval system