KEGG   Homo sapiens (human): 9966Help
Entry
9966              CDS       T01001                                 

Gene name
TNFSF15, TL1, TL1A, VEGI, VEGI192A
Definition
tumor necrosis factor (ligand) superfamily, member 15
Orthology
K05478  
tumor necrosis factor ligand superfamily member 15
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00286  
Crohn's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9966 (TNFSF15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q32
AA seq 192 aa AA seqDB search
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHW
EHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITV
VITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYT
KEDKTFFGAFLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcacaaagggccgtcttcatttcagtcaccctttgtctcatacaaagcacatt
tctccttttgttacagatgcacctcttagagcagacggagataagccaagggcacacctg
acagttgtgagacaaactcccacacagcactttaaaaatcagttcccagctctgcactgg
gaacatgaactaggcctggccttcaccaagaaccgaatgaactataccaacaaattcctg
ctgatcccagagtcgggagactacttcatttactcccaggtcacattccgtgggatgacc
tctgagtgcagtgaaatcagacaagcaggccgaccaaacaagccagactccatcactgtg
gtcatcaccaaggtaacagacagctaccctgagccaacccagctcctcatggggaccaag
tctgtatgcgaagtaggtagcaactggttccagcccatctacctcggagccatgttctcc
ttgcaagaaggggacaagctaatggtgaacgtcagtgacatctctttggtggattacaca
aaagaagataaaaccttctttggagccttcttactatag

DBGET integrated database retrieval system