KEGG   Homo sapiens (human): 997Help
Entry
997               CDS       T01001                                 

Gene name
CDC34, E2-CDC34, UBC3, UBCH3, UBE2R1
Definition
cell division cycle 34 (EC:6.3.2.19)
Orthology
K02207  
ubiquitin-conjugating enzyme E2 R [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    997 (CDC34)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    997 (CDC34)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     997 (CDC34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 236 aa AA seqDB search
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctcggccgctagtgcccagctcgcagaaggcgctgctgctggagctcaaggggctg
caggaagagccggtcgagggattccgcgtgacactggtggacgagggcgatctatacaac
tgggaggtggccatcttcgggccccccaacacctactacgagggcggctacttcaaggcg
cgcctcaagttccccatcgactacccatactctccaccagcctttcggttcctgaccaag
atgtggcaccctaacatctacgagacgggggacgtgtgtatctccatcctccacccgccg
gtggacgacccccagagcggggagctgccctcagagaggtggaaccccacgcagaacgtc
aggaccattctcctgagtgtgatctccctcctgaacgagcccaacaccttctcgcccgca
aacgtggacgcctccgtgatgtacaggaagtggaaagagagcaaggggaaggatcgggag
tacacagacatcatccggaagcaggtcctggggaccaaggtggacgcggagcgtgacggc
gtgaaggtgcccaccacgctggccgagtactgcgtgaagaccaaggcgccggcgcccgac
gagggctcagacctcttctacgacgactactacgaggacggcgaggtggaggaggaggcc
gacagctgcttcggggacgatgaggatgactctggcacggaggagtcctga

DBGET integrated database retrieval system