KEGG   Homo sapiens (human): 997Help
Entry
997               CDS       T01001                                 

Gene name
CDC34, E2-CDC34, UBC3, UBCH3, UBE2R1
Definition
(RefSeq) cell division cycle 34
  KO
K02207  
ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    997 (CDC34)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    997 (CDC34)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     997 (CDC34)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   997 (CDC34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49427(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 236 aa AA seqDB search
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctcggccgctagtgcccagctcgcagaaggcgctgctgctggagctcaaggggctg
caggaagagccggtcgagggattccgcgtgacactggtggacgagggcgatctatacaac
tgggaggtggccatcttcgggccccccaacacctactacgagggcggctacttcaaggcg
cgcctcaagttccccatcgactacccatactctccaccagcctttcggttcctgaccaag
atgtggcaccctaacatctacgagacgggggacgtgtgtatctccatcctccacccgccg
gtggacgacccccagagcggggagctgccctcagagaggtggaaccccacgcagaacgtc
aggaccattctcctgagtgtgatctccctcctgaacgagcccaacaccttctcgcccgca
aacgtggacgcctccgtgatgtacaggaagtggaaagagagcaaggggaaggatcgggag
tacacagacatcatccggaagcaggtcctggggaccaaggtggacgcggagcgtgacggc
gtgaaggtgcccaccacgctggccgagtactgcgtgaagaccaaggcgccggcgcccgac
gagggctcagacctcttctacgacgactactacgaggacggcgaggtggaggaggaggcc
gacagctgcttcggggacgatgaggatgactctggcacggaggagtcctga

DBGET integrated database retrieval system