KEGG   Homo sapiens (human): 9970Help
Entry
9970              CDS       T01001                                 

Gene name
NR1I3, CAR, CAR1, MB67
Definition
(RefSeq) nuclear receptor subfamily 1 group I member 3
  KO
K08541  
constitutive androstane receptor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    9970 (NR1I3)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   9970 (NR1I3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 352 aa AA seqDB search
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR
RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA
HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP
VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV
EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI
KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccagtagggaagatgagctgaggaactgtgtggtatgtggggaccaagccacaggc
taccactttaatgcgctgacttgtgagggctgcaagggtttcttcaggagaacagtcagc
aaaagcattggtcccacctgcccctttgctggaagctgtgaagtcagcaagactcagagg
cgccactgcccagcctgcaggttgcagaagtgcttagatgctggcatgaggaaagacatg
atactgtcggcagaagccctggcattgcggcgagcaaagcaggcccagcggcgggcacag
caaacacctgtgcaactgagtaaggagcaagaagagctgatccggacactcctgggggcc
cacacccgccacatgggcaccatgtttgaacagtttgtgcagtttaggcctccagctcat
ctgttcatccatcaccagcccttgcccaccctggcccctgtgctgcctctggtcacacac
ttcgcagacatcaacactttcatggtactgcaagtcatcaagtttactaaggacctgccc
gtcttccgttccctgcccattgaagaccagatctcccttctcaagggagcagctgtggaa
atctgtcacatcgtactcaataccactttctgtctccaaacacaaaacttcctctgcggg
cctcttcgctacacaattgaagatggagcccgtgtatctcccacagtggggttccaggta
gagtttttggagttgctctttcacttccatggaacactacgaaaactgcagctccaagag
cctgagtatgtgctcttggctgccatggccctcttctctcctgaccgacctggagttacc
cagagagatgagattgatcagctgcaagaggagatggcactgactctgcaaagctacatc
aagggccagcagcgaaggccccgggatcggtttctgtatgcgaagttgctaggcctgctg
gctgagctccggagcattaatgaggcctacgggtaccaaatccagcacatccagggcctg
tctgccatgatgccgctgctccaggagatctgcagctga

DBGET integrated database retrieval system