KEGG   Homo sapiens (human): 9971Help
Entry
9971              CDS       T01001                                 

Gene name
NR1H4, BAR, FXR, HRR-1, HRR1, RIP14
Definition
nuclear receptor subfamily 1, group H, member 4
Orthology
K08537  
farnesoid X receptor
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Drug target
Chenodeoxycholic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    9971 (NR1H4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    9971 (NR1H4)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   9971 (NR1H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 476 aa AA seqDB search
MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGR
IKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQ
ECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT
KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQ
VLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSG
ISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQ
KLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaaaaatgaatctcattgaacattcccatttacctaccacagatgaattttct
ttttctgaaaatttatttggtgttttaacagaacaagtggcaggtcctctgggacagaac
ctggaagtggaaccatactcgcaatacagcaatgttcagtttccccaagttcaaccacag
atttcctcgtcatcctattattccaacctgggtttctacccccagcagcctgaagagtgg
tactctcctggaatatatgaactcaggcgtatgccagctgagactctctaccagggagaa
actgaggtagcagagatgcctgtaacaaagaagccccgcatgggcgcgtcagcagggagg
atcaaaggggatgagctgtgtgttgtttgtggagacagagcctctggataccactataat
gcactgacctgtgaggggtgtaaaggtttcttcaggagaagcattaccaaaaacgctgtg
tacaagtgtaaaaacgggggcaactgtgtgatggatatgtacatgcgaagaaagtgtcaa
gagtgtcgactaaggaaatgcaaagagatgggaatgttggctgaatgtatgtatacaggc
ttgttaactgaaattcagtgtaaatctaagcgactgagaaaaaatgtgaagcagcatgca
gatcagaccgtgaatgaagacagtgaaggtcgtgacttgcgacaagtgacctcgacaaca
aagtcatgcagggagaaaactgaactcaccccagatcaacagactcttctacattttatt
atggattcatataacaaacagaggatgcctcaggaaataacaaataaaattttaaaagaa
gaattcagtgcagaagaaaattttctcattttgacggaaatggcaaccaatcatgtacag
gttcttgtagaattcacaaaaaagctaccaggatttcagactttggaccatgaagaccag
attgctttgctgaaagggtctgcggttgaagctatgttccttcgttcagctgagattttc
aataagaaacttccgtctgggcattctgacctattggaagaaagaattcgaaatagtggt
atctctgatgaatatataacacctatgtttagtttttataaaagtattggggaactgaaa
atgactcaagaggagtatgctctgcttacagcaattgttatcctgtctccagatagacaa
tacataaaggatagagaggcagtagagaagcttcaggagccacttcttgatgtgctacaa
aagttgtgtaagattcaccagcctgaaaatcctcaacactttgcctgtctcctgggtcgc
ctgactgaattacggacattcaatcatcaccacgctgagatgctgatgtcatggagagta
aacgaccacaagtttaccccacttctctgtgaaatctgggacgtgcagtga

DBGET integrated database retrieval system