KEGG   Homo sapiens (human): 9973Help
Entry
9973              CDS       T01001                                 

Gene name
CCS
Definition
copper chaperone for superoxide dismutase
Orthology
K04569  
copper chaperone for superoxide dismutase
Organism
hsa  Homo sapiens (human)
Pathway
Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    9973 (CCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 274 aa AA seqDB search
MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQ
EVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTID
GLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI
FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggattcggggaaccaggggaccctctgcacgttggagttcgcggtgcagatg
acctgtcagagctgtgtggacgcggtgcgcaaatccctgcaaggggtggcaggtgtccag
gatgtggaggtgcacttggaggaccagatggtcttggtacacaccactctacccagccag
gaggtgcaggctctcctggaaggcacggggcggcaggcggtactcaagggcatgggcagc
ggccagttgcagaatctgggggcagcagtggccatcctgggggggcctggcaccgtgcag
ggggtggtgcgcttcctacagctgacccctgagcgctgcctcatcgagggaactattgac
ggcctggagcctgggctgcatggactccacgtccatcagtacggggaccttacaaacaac
tgcaacagctgtgggaatcactttaaccctgatggagcatctcatgggggcccccaggac
tctgaccggcaccgcggagacctgggcaatgtccgtgctgatgctgacggccgcgccatc
ttcagaatggaggatgagcagctgaaggtgtgggatgtgattggccgcagcctgattatt
gatgagggagaagatgacctgggccggggaggccatcccttatccaagatcacagggaac
tccggggagaggttggcctgtggcatcattgcacgctccgctggccttttccagaacccc
aagcagatctgctcttgcgatggcctcaccatctgggaggagcgaggccggcccatcgct
ggcaagggccgaaaggagtcagcgcagccccctgcccacctttga

DBGET integrated database retrieval system