KEGG   Homo sapiens (human): 9973Help
Entry
9973              CDS       T01001                                 

Gene name
CCS
Definition
(RefSeq) copper chaperone for superoxide dismutase
  KO
K04569  copper chaperone for superoxide dismutase
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    9973 (CCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu HMA
Motif
Other DBs
NCBI-GeneID: 9973
NCBI-ProteinID: NP_005116
OMIM: 603864
HGNC: 1613
Ensembl: ENSG00000173992
Vega: OTTHUMG00000167238
Pharos: O14618(Tbio)
UniProt: O14618
Structure
PDB: 

Jmol
Position
11q13.2
AA seq 274 aa AA seqDB search
MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQ
EVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTID
GLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI
FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNP
KQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggattcggggaaccaggggaccctctgcacgttggagttcgcggtgcagatg
acctgtcagagctgtgtggacgcggtgcgcaaatccctgcaaggggtggcaggtgtccag
gatgtggaggtgcacttggaggaccagatggtcttggtacacaccactctacccagccag
gaggtgcaggctctcctggaaggcacggggcggcaggcggtactcaagggcatgggcagc
ggccagttgcagaatctgggggcagcagtggccatcctgggggggcctggcaccgtgcag
ggggtggtgcgcttcctacagctgacccctgagcgctgcctcatcgagggaactattgac
ggcctggagcctgggctgcatggactccacgtccatcagtacggggaccttacaaacaac
tgcaacagctgtgggaatcactttaaccctgatggagcatctcatgggggcccccaggac
tctgaccggcaccgcggagacctgggcaatgtccgtgctgatgctgacggccgcgccatc
ttcagaatggaggatgagcagctgaaggtgtgggatgtgattggccgcagcctgattatt
gatgagggagaagatgacctgggccggggaggccatcccttatccaagatcacagggaac
tccggggagaggttggcctgtggcatcattgcacgctccgctggccttttccagaacccc
aagcagatctgctcttgcgatggcctcaccatctgggaggagcgaggccggcccatcgct
ggcaagggccgaaaggagtcagcgcagccccctgcccacctttga

DBGET integrated database retrieval system