KEGG   Homo sapiens (human): 9984Help
Entry
9984              CDS       T01001                                 

Gene name
THOC1, HPR1, P84, P84N5
Definition
THO complex 1
Orthology
K12878  
THO complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Spliceosome
Module
THC complex
TREX complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9984 (THOC1)
  Translation
   03013 RNA transport
    9984 (THOC1)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9984 (THOC1)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    9984 (THOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.32
AA seq 657 aa AA seqDB search
MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILE
EEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNV
ATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQ
FNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS
LQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAK
FLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
YQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPE
DFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMV
ENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEI
KTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIR
QIECDSEDMKMRAKQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgacgccgccgctcttcagtttgcccgaagcgcggacgcggtttacgaagtct
accagagaggccttgaacaacaaaaacatcaagccattgttaagtaccttcagccaggta
cctggcagtgaaaatgaaaaaaaatgtacccttgaccaagctttcagaggtattctagaa
gaagaaattataaatcattcatcatgtgaaaacgttttagctattatttctcttgctatt
gggggagtaactgaaggtatttgtaccgcatctacaccttttgtattgttgggagatgtt
ttggattgtcttcctttggatcagtgtgacacaatattcacttttgtggaaaaaaatgtt
gctacttggaaatcaaatacattctattctgctgggaaaaattacttactacgtatgtgc
aatgatctcctaagaagattgtctaaatcccagaatacagtcttctgtggacggattcag
ctctttttggccaggcttttccctctgtctgagaaatcaggtcttaacttgcagagtcag
tttaatctggaaaatgtcactgttttcaatacaaatgagcaggaaagcaccctgggtcag
aagcacactgaagatagagaagaaggaatggatgtagaagaaggcgaaatgggagacgag
gaagctccaacaacgtgctctattccaattgattacaacctgtatcgaaaattctggtca
cttcaggattacttcaggaaccctgtgcaatgctatgagaagatttcatggaaaactttt
ctcaagtattctgaagaagttttagctgtttttaagagttataaattagatgatactcag
gcctcaagaaaaaagatggaagaattgaaaacaggaggagaacatgtatattttgcaaaa
tttttaacaagtgaaaagctgatggatttacaactgagtgacagtaactttcgtcgacac
atcctgttgcagtatctcattttattccaatatctcaaggggcaggtcaaattcaaaagt
tcaaactatgttttaactgatgagcaatcactttggattgaagatactacaaaatcagtt
tatcaactactatctgaaaacccccccgatggagaaagattttcaaagatggtagagcat
atattaaacactgaagaaaactggaactcgtggaaaaatgaaggttgcccaagttttgtg
aaagaaagaacatcagataccaaacctacgagaataattcggaagagaacagcacccgag
gacttcctagggaaaggacccaccaaaaaaattctgatgggaaatgaggagttaacaagg
ctttggaatctttgccctgataatatggaagcctgtaaatcagagacaagggaacacatg
cccactttggaggaattctttgaagaagccattgaacaggcagaccctgaaaatatggtg
gaaaatgaatataaggctgtgaacaattcaaattatggttggagagccctgagactatta
gcacggagaagccctcacttcttccagccaaccaaccagcagtttaaaagtttaccagaa
tatcttgaaaatatggtaataaagctagccaaggaattaccgcctccttctgaagaaata
aaaacaggtgaggatgaagatgaggaagataatgatgctctactgaaggaaaatgaaagt
cctgatgttcggcgagacaaacctgtaacaggagaacaaatagaggtatttgccaacaag
ctgggtgaacaatggaagattctggctccctacttggaaatgaaagactcagaaattagg
cagattgagtgtgacagtgaagacatgaagatgagagctaagcagctcctggttgcctgg
caagatcaagagggagttcatgcaacacctgagaatctgattaatgcactgaataagtct
ggattaagtgaccttgcagaaagtctaactaatgacaatgagacaaatagttag

DBGET integrated database retrieval system