KEGG   Homo sapiens (human): 9985Help
Entry
9985              CDS       T01001                                 

Gene name
REC8, HR21spB, REC8L1, Rec8p
Definition
REC8 meiotic recombination protein
Orthology
K13054  
meiotic recombination protein REC8, animal type
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    9985 (REC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2-q12
AA seq 547 aa AA seqDB search
MFYYPNVLQRHTGCFATIWLAATRGSRLVKREYLRVNVVKTCEEILNYVLVRVQPPQPGL
PRPRFSLYLSAQLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLP
NHLAMMETLEDAPDPFFGMMSVDPRLPSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPRE
PERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLIAEEEEAILLEIPRLP
PPAPAEVEGIGEALGPEELRLTGWEPGALLMEVTPPEELRLPAPPSPERRPPVPPPPRRR
RRRRLLFWDKETQISPEKFQEQLQTRAHCWECPMVQPPERTIRGPAELFRTPTLSGWLPP
ELLGLWTHCAQPPPKALRRELPEEAAAEEERRKIEVPSEIEVPREALEPSVPLMVSLEIS
LEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLE
AVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLI
QPGPRFH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgttctactatcccaacgtgcttcagcgccacaccggctgctttgccaccatctggctg
gcggcgactcgcggcagccggttggtgaagcgcgaatacctgagggtgaatgtggtgaaa
acctgcgaggaaatcctcaattacgtgctggtacgagtgcaacccccgcagcccggcctg
ccgcggccccgcttctccctctatctctcagcccaacttcagatcggtgtgatccgcgtc
tattctcaacaatgccagtacctcgtggaggacatccagcacatcttggagcgcctccac
cgtgcccagctgcagatccgaatagatatggagactgagctacccagcctgctgcttcct
aaccacctggccatgatggagaccctagaagatgctccagatcccttttttgggatgatg
tctgtggatcccagacttcctagtcctttcgatatccctcagattcgacacctcttagag
gctgcaatcccagagagagttgaagagatccctcctgaagttcctacagagcccagggag
ccagagaggattccggtcactgtgctgccacctgaggccatcacgatcctggaggcagag
cccatacggatgctggagattgagggtgaacgggagctcccagaggtcagccgccgagaa
ctggacctgctgatcgcagaggaagaagaagctatcttgttagaaatcccgcggctccca
cctccagctcctgcagaggtggaaggaataggagaggcactgggtcctgaggagctgagg
ctgacaggctgggaacctggggccctactcatggaggtgacccccccggaggagctgcgt
ctgccagccccacccagcccagagaggaggcccccagtccccccacctcctcgccgccgc
cgtcgtcgccggttactgttctgggacaaggagactcagatctccccggagaaattccag
gaacaactgcaaaccagagcccactgctgggaatgtcctatggtgcagccgcccgagagg
accatcagaggccctgcggagttgttcagaaccccaactctctctggctggctaccccct
gaactactgggtctctggacccattgtgcccagccacccccaaaagccctcaggcgagag
ctgcctgaggaggcagccgctgaggaggaaaggagaaagattgaagttccaagtgagatt
gaggtcccgagggaggccctggagcccagtgttccccttatggtgtctttagagatctcc
ctagaggcagctgaagaggagaagtcccgcatcagcctcatcccaccagaagaacggtgg
gcctggcctgaggtggaggcgccagaagctcctgcattgcccgtggtgcctgaactccct
gaggtgcccatggagatgcctttggtgctgcccccagagctcgagctgctctcactggaa
gcagtgcacagggcagtggcactggagctgcaggctaacagggagcccgacttcagcagc
ctggtgtcacctctcagcccccgcaggatggctgcccgggtcttctacctgctcctggtg
ctctcagcgcaacagattcttcacgtgaaacaagaaaagccatatggtcgcctcctgatc
cagccggggcccagattccactga

DBGET integrated database retrieval system