KEGG   Homo sapiens (human): 9990Help
Entry
9990              CDS       T01001                                 

Gene name
SLC12A6, ACCPN, KCC3, KCC3A, KCC3B
Definition
(RefSeq) solute carrier family 12 member 6
  KO
K14427  
solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
hsa  Homo sapiens (human)
Disease
H00816  
Agenesis of the corpus callosum with peripheral neuropathy (ACCPN)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   9990 (SLC12A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q13
AA seq 1150 aa AA seqDB search
MHPPETTTKMASVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPM
SEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNS
NYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPT
KTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSA
IATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAA
IFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYA
GAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATC
DEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVD
ITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGA
CIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAK
DNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLA
CALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFA
SQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGIS
HLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFP
SNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDL
ATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKD
RNSMLRLTSIGSDEDEETETYQEKVHMTWTKDKYMASRGQKAKSMEGFQDLLNMRPDQSN
VRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRG
GGSEVITIYS
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctccagaaaccaccaccaagatggcttcagttcggttcatggtgacaccgaca
aagatcgatgacattccaggtttgtcagacaccagtccggacctcagctctcgatctagt
tcccgagtaagatttagctcccgggaaagcgtgcctgaaacaagccggagtgagcctatg
agtgagatgtctggggccaccacttcgctggcaactgttgcactggatccacccagtgac
cggacttctcacccccaggatgtcatcgaggacctgagtcagaactccatcacaggggaa
cacagccaactgttagacgacggacataagaaagctcgaaatgcttatctcaataattcc
aattatgaagaaggagatgaatattttgataaaaatttggcactctttgaggaagaaatg
gacaccagaccgaaggtgtcttccctcctcaaccgcatggccaattacactaatctgact
caaggagcaaaggaacatgaagaggcagaaaacatcactgaagggaaaaagaagcccacc
aagaccccccaaatgggtaccttcatgggtgtctacctcccatgtctacaaaatattttt
ggagtgatcctttttttacgccttacatgggtggtgggcacagctggagttcttcaggct
tttgcaattgtccttatctgctgctgctgtacaatgttgactgctatctccatgagtgcc
attgccactaatggagtggtgccagctgggggctcatactttatgatttcccgggcactg
ggcccagagtttggtggggctgttggcctctgcttttatcttggtaccacatttgcagca
gccatgtacatccttggtgccattgaaatctttctggtctatatcgtcccccgagctgcc
atctttcacagtgatgacgcactcaaggaatcagcagccatgctaaataacatgcgtgtc
tacggcacagctttcttggtccttatggtattagtggtatttatcggcgtacgctatgtg
aacaagtttgcctcacttttcctggcctgtgtcattgtgtccatcttggccatctatgct
ggagccatcaagtcttcttttgctcctccacacttcccggtctgcatgctgggtaaccgc
accctttcatcaagacacattgacgtttgctctaagaccaaggaaattaacaacatgaca
gtcccatcaaagttatggggattcttctgtaactcgagtcaatttttcaatgccacctgt
gatgaatactttgttcacaataacgtcacttcaatccagggcattcctggattggctagt
ggtataattacagagaatctttggagtaattacctacccaagggagagatcatcgaaaag
ccttcagccaaatcttctgatgtcttaggcagcttaaaccatgaatatgttcttgttgac
atcaccacctccttcacgcttctggtgggaatcttctttccctctgttacaggtatcatg
gctggatcaaacagatctggagatctgaaagatgctcagaagtctattccgattggtact
atccttgccatcctgaccacctcctttgtttatttaagcaatgttgtcctttttggtgca
tgtattgaaggggttgttctcagagacaagttcggtgatgctgtgaaaggtaatttggtg
gtaggcaccttatcttggccatccccatgggtgattgttattggctccttcttttcaaca
tgtggggctggacttcagagcctcacaggtgcaccgaggctgctacaagctattgccaag
gataacatcataccgtttctgagggtttttggccacagcaaagccaatggggaacctacc
tgggctttacttctaactgctgccattgcagagcttggaatactcattgcctccctggat
cttgtggccccaattctttccatgttttttctcatgtgttacctctttgtaaacttggca
tgtgccttgcaaacattacttcgaacacccaactggagaccccgattccgctactaccat
tgggccctttctttcatgggaatgagtatctgtctggctctgatgttcatttcttcctgg
tattatgccattgtagccatggtaatagctggtatgatctacaagtacattgaataccaa
ggagctgagaaagaatggggtgatggtatccgtgggctgtccctcagtgcagcccggttt
gctttgcttcgattggaggaaggacctccacacactaaaaactggaggcctcagttgctt
gtattactgaaactagatgaagacttacatgtcaagcatcctcgcctcctcacctttgcc
tcacagctcaaagcaggaaaaggtctcactattgtgggctctgtcatcgtggggaacttc
ctagagaactacggtgaagctttagctgctgagcagaccataaagcacctaatggaggca
gagaaggtaaaaggattctgccagctggtggtggccgccaagctgagagagggcatttcc
cacctcatccagtcatgtggccttgggggcatgaagcacaacacggtggtgatgggctgg
cctaatggctggcgtcaaagcgaagatgcccgcgcttggaagacttttattggcacagtt
cgagtgacaactgctgcccatcttgcactgctggtggctaaaaacatctccttctttccc
agcaatgtggagcaattttctgagggcaacattgatgtgtggtggattgtgcatgatggg
gggatgcttatgctactaccattcctactgaaacagcacaaggtgtggcgaaagtgcagc
atacggatcttcacagtagcccaattagaagacaacagtatccaaatgaagaaggaccta
gccaccttcctatatcacttacgcattgaggcggaggtagaagtggtggagatgcatgac
agtgatatatcagcatatacttacgagcgcactttgatgatggaacaaaggtcccagatg
ctccggcacatgcggctatccaaaacagagcgagacagagaggcacaattggtgaaagac
cgaaactcaatgctacgattgaccagcattggctctgatgaggacgaagagacagaaacc
tatcaggagaaggtgcacatgacttggacaaaagacaagtacatggcatcccggggacaa
aaagcgaagtcaatggaaggattccaggacctgcttaacatgcgtccggaccagtccaat
gtgaggcggatgcatacagcagtgaaactcaacgaggttatagttaacaagtcccatgaa
gcaaagctggttttattgaatatgccagggccaccccgaaaccctgagggtgatgaaaac
tacatggagttcctagaggtgcttaccgagggactagagcgagtcctacttgtccggggt
ggtggcagtgaagtgatcaccatttattcataa

DBGET integrated database retrieval system