KEGG   Herbaspirillum seropedicae SmR1: Hsero_0062Help
Entry
Hsero_0062        CDS       T01268                                 

Gene name
speB
Definition
(GenBank) arginase/agmatinase/formimionoglutamate hydrolase protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00220  Arginine biosynthesis
hse00330  Arginine and proline metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01130  Biosynthesis of antibiotics
hse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Hsero_0062 (speB)
   00330 Arginine and proline metabolism
    Hsero_0062 (speB)
Enzymes [BR:hse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Hsero_0062 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADJ61592
UniProt: D8ITV1
Position
75471..76379
Genome map
AA seq 302 aa AA seqDB search
MNRIRMMGAPTDVGASRRGASMAPAALRVAELQRGLQQHGLDVIDGGDLAGPANPQQPPV
QGLRHLEQVVQWNQTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHCRSQGKELRV
LWLDAHADANTSQSTPTGNIHGMPVACLLGVGPAALTAIGGQTPALQPQQICQVGIRSVD
REEKRHLRELGVRVFDMRHIDEYGMRQTMEEALAGVGPQTHLHVSFDVDFLDAALAPGVG
TAVPGGPTYREAQLCMEMIADTGALASLDVMELNPACDVRNQTAELVVDLVESLFGKSTL
IR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatcaggatgatgggcgcgcccaccgacgtgggcgccagccggcgcggggca
tcgatggccccggcggccttgcgcgtggccgaattgcagcgcggtctgcagcagcacggg
ctggatgtcatcgatggcggcgacctggccggaccggccaatccgcagcagccgccggtg
cagggattgcgccacctggaacaggtggtgcaatggaaccagacggtccatgaggccgtg
gcgcaatgcctggcggacggcgagctgccgctgctcatgggcggcgaccatgcgctggcg
gtcggttcgattgccgccgtggcggcgcattgccgcagccagggcaaggagctgcgcgtc
ctgtggctggacgcccacgccgacgccaacaccagccagtccaccccgaccggcaatatc
cacggcatgccggtggcctgcctgctgggggtaggaccggcggcgctgacggccatcggc
ggccagacgccggccttgcagccgcagcagatctgccaggtcggcattcgcagcgtcgac
cgcgaagagaagcgccatctgcgcgaactgggtgtgcgggtgttcgacatgcgccacatc
gacgaatacggcatgcgccagaccatggaagaggcgctggccggcgtggggccgcagacc
catctgcatgtgagtttcgatgtggatttcctggacgccgcgctggccccgggtgtgggt
actgcggtgccgggtggtcccacctaccgggaagcgcagctgtgcatggaaatgatcgcc
gacaccggcgcgctggcctcgctggacgtgatggaactcaatcccgcctgcgatgtgcgc
aaccagactgccgaactggtggtggacctggtggaaagcctgttcgggaaatccacactg
attcgctga

DBGET integrated database retrieval system