KEGG   Herbaspirillum seropedicae: Hsero_0062Help
Entry
Hsero_0062        CDS       T01268                                 

Gene name
speB
Definition
arginase/agmatinase/formimionoglutamate hydrolase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hsero_0062 (speB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hsero_0062 (speB)
Enzymes [BR:hse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Hsero_0062 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75471..76379
Genome map
AA seq 302 aa AA seqDB search
MNRIRMMGAPTDVGASRRGASMAPAALRVAELQRGLQQHGLDVIDGGDLAGPANPQQPPV
QGLRHLEQVVQWNQTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHCRSQGKELRV
LWLDAHADANTSQSTPTGNIHGMPVACLLGVGPAALTAIGGQTPALQPQQICQVGIRSVD
REEKRHLRELGVRVFDMRHIDEYGMRQTMEEALAGVGPQTHLHVSFDVDFLDAALAPGVG
TAVPGGPTYREAQLCMEMIADTGALASLDVMELNPACDVRNQTAELVVDLVESLFGKSTL
IR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatcaggatgatgggcgcgcccaccgacgtgggcgccagccggcgcggggca
tcgatggccccggcggccttgcgcgtggccgaattgcagcgcggtctgcagcagcacggg
ctggatgtcatcgatggcggcgacctggccggaccggccaatccgcagcagccgccggtg
cagggattgcgccacctggaacaggtggtgcaatggaaccagacggtccatgaggccgtg
gcgcaatgcctggcggacggcgagctgccgctgctcatgggcggcgaccatgcgctggcg
gtcggttcgattgccgccgtggcggcgcattgccgcagccagggcaaggagctgcgcgtc
ctgtggctggacgcccacgccgacgccaacaccagccagtccaccccgaccggcaatatc
cacggcatgccggtggcctgcctgctgggggtaggaccggcggcgctgacggccatcggc
ggccagacgccggccttgcagccgcagcagatctgccaggtcggcattcgcagcgtcgac
cgcgaagagaagcgccatctgcgcgaactgggtgtgcgggtgttcgacatgcgccacatc
gacgaatacggcatgcgccagaccatggaagaggcgctggccggcgtggggccgcagacc
catctgcatgtgagtttcgatgtggatttcctggacgccgcgctggccccgggtgtgggt
actgcggtgccgggtggtcccacctaccgggaagcgcagctgtgcatggaaatgatcgcc
gacaccggcgcgctggcctcgctggacgtgatggaactcaatcccgcctgcgatgtgcgc
aaccagactgccgaactggtggtggacctggtggaaagcctgttcgggaaatccacactg
attcgctga

DBGET integrated database retrieval system