KEGG   Herbaspirillum seropedicae: Hsero_0097Help
Entry
Hsero_0097        CDS       T01268                                 

Gene name
tufB
Definition
EF-Tu elongation factor protein
Orthology
K02358  
elongation factor Tu
Organism
hse  Herbaspirillum seropedicae
Brite
Mitochondrial biogenesis [BR:hse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Hsero_0097 (tufB)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Hsero_0097 (tufB)
  Exosomal proteins of breast cancer cells
   Hsero_0097 (tufB)
  Exosomal proteins of colorectal cancer cells
   Hsero_0097 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110426..111616
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIIVFLNKADMVDDAELLELVEMEVRELLSKYEFPGDDLPIVKGSAKLALE
GDTGPLGEQAIMALAEALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVQRGQVLAKPGS
IKPHKHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPKDKEMVMPGDNVS
ITVQLINPIAMEEGLRFAIREGGRTVGAGVVAKIFD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggcaagtttgaacggaccaagccgcacgtgaacgtcggcaccatcggtcac
gttgaccacggcaagaccaccctgaccgctgcaatcgcaaccgttctgtcgaagaagttc
ggcggcgaagcgaaggcctacgaccagatcgacgcagcgcctgaagaaaaggcccgcggc
atcaccatcaacaccgcgcacgtcgaatacgaaaccgcaaaccgtcactacgcacacgtt
gactgcccaggccacgccgactatgtgaagaacatgatcaccggcgcagcgcagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccccagacccgtgaacacatc
ctgctgtcccgccaggttggcgtgccttacatcatcgtcttcctgaacaaggctgacatg
gtggacgacgctgaactgctggaactggtggaaatggaagtccgtgaactgctgtcgaag
tacgagttccctggcgacgacctgcccatcgtgaagggttcggccaagctggcgctggaa
ggcgacaccggtcccctgggcgagcaagccatcatggccctggccgaagcactggacacc
tacatcccgaccccggaacgtgccgttgacggtaccttcctgatgccggtggaagacgtg
ttctcgatctccggccgtggcaccgtggtgaccggtcgcgttgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatcgctgacacccagaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaagctggcgacaacgttggcgtgctg
ctgcgcggcaccaagcgtgaagacgtgcagcgtggccaggttctggccaagccgggttcg
atcaagccgcacaagcacttcaccggcgagatctatgttctgtcgaaggatgaaggcggc
cgtcacaccccgttcttcaacaactaccgtccgcagttctacttccgtaccaccgacgtg
accggtgcgatcgaactgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcaccgtgcaactgatcaacccgatcgctatggaagaaggtctgcgcttcgctatccgt
gaaggcggtcgtaccgtcggcgccggcgtggttgccaagatcttcgactaa

DBGET integrated database retrieval system