KEGG   Herbaspirillum seropedicae: Hsero_0421Help
Entry
Hsero_0421        CDS       T01268                                 

Gene name
ruvA
Definition
Holliday junction DNA resolvase DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hse  Herbaspirillum seropedicae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hsero_0421 (ruvA)
Enzymes [BR:hse01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Hsero_0421 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455531..456109
Genome map
AA seq 192 aa AA seqDB search
MIGRLSGILLEKLPPNLLVDCQGVGYEVAVPMSTYYNLPALGEKVTLLTHLAIREDAHIL
FGFGTAEERNTFKELIKISGVGARTALSILSGMSVADLAQAVTLQEAGRLTRVPGIGKKT
AERLLLELKGKLGADLGAVAGVVHSDASADILNALLALGYSDKEATLAMKQVPKDSTVSD
GIKLALKALSKG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcctctccggaattcttctcgaaaaacttccccccaacctgctggtggac
tgccagggcgtcggctatgaagtggccgtgcccatgagcacctactacaacctgccggcc
ctgggcgagaaggtcacgttgctgacgcacctggccatccgcgaggatgcgcacatcctg
ttcgggtttgggactgccgaagagcgcaatacgttcaaggagctgatcaagatttcgggc
gtgggcgcgcgtaccgcgctgtccatcctctcgggcatgtcggtggccgacctggcccag
gccgtcaccctgcaggaagccggtcgcctcacccgtgtgcccggcatcggcaagaagacc
gccgaacgcctgctgctggagttgaagggcaagctcggcgccgatctgggcgcggtggcc
ggcgtggtccacagcgacgccagcgccgacattctcaacgccctgctggcgctgggctat
tcggacaaggaagcgaccctggccatgaagcaggtgcccaaggacagtaccgtctcggac
ggcatcaagctggccctgaaggcgctttccaagggctga

DBGET integrated database retrieval system