KEGG   Herbaspirillum seropedicae: Hsero_0472Help
Entry
Hsero_0472        CDS       T01268                                 

Gene name
cpsG
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_0472 (cpsG)
   00030 Pentose phosphate pathway
    Hsero_0472 (cpsG)
   00051 Fructose and mannose metabolism
    Hsero_0472 (cpsG)
   00052 Galactose metabolism
    Hsero_0472 (cpsG)
   00500 Starch and sucrose metabolism
    Hsero_0472 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_0472 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    Hsero_0472 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hsero_0472 (cpsG)
Enzymes [BR:hse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hsero_0472 (cpsG)
    5.4.2.8  phosphomannomutase
     Hsero_0472 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513348..514724
Genome map
AA seq 458 aa AA seqDB search
MTSLSPSIFKAYDIRGIIGKTLDGTVAYRIGQAFGAAALAKGQKKVVIGRDGRLSGPELA
AELARGLQAVGVDVIDLGMVATPMVYFGTHVLDTQSGIMVTGSHNPPDYNGFKMVLAGEA
IHGETIQALYHAIVKGDFPQGAGGYATHDIKAAYIERMLADVKLARPLKIAVDCGNGVAG
AFAGEIYRTLGCEVTELFCEVDGTFPNHHPDPAHPENLQDLIRCLRETDCELGLAFDGDG
DRLGLVTKDGQIIYPDRQLMLFAEDVLTRHPGKEILYDVKCTRHLAPWITARGGRPLMWK
TGHSLVKAKLRETGAPLGGEMSGHIFFKDRWFGFDDGLYAGVRMLELMARQADPSAVLNA
LPQSVSTPELQLKLQEGENVALIGKLQGEASFEGAQEIIAIDGLRVEYPDGFGLARSSNT
TPVVVLRFEAETPEALARIQAQFRQAILAVRPEVALPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcactttcaccctccatcttcaaggcttacgacatccgcggcatcatcggcaag
acgctcgatggcacggtagcgtatcgcatcggccaggcctttggcgccgccgccctggcc
aagggacagaagaaggtcgtgatcggtcgcgatggtcgtctctccgggcctgaactggct
gccgaactggctcgcggcctgcaggcggtgggcgtggatgtgatcgacctgggcatggtg
gccactcccatggtctacttcggcacccatgtgctggacacccagtcgggcatcatggtc
accggcagccacaatccgccggactataacggtttcaagatggtgctggccggcgaggcc
atccacggcgagaccatccaggcgctctaccacgccatcgtcaagggcgacttcccgcag
ggcgcgggcggctacgccactcatgacatcaaggccgcctatatcgagcgcatgctcgcc
gacgtcaagctggcgcgtccgctgaagatcgccgtggattgcggcaatggcgtggccggc
gcatttgctggcgagatctaccggacgctgggctgcgaggtgaccgagctgttctgcgaa
gtcgacggcaccttccccaatcatcatcccgatccggcccatccggaaaacctgcaagac
ctgatccgctgcctgcgcgagaccgactgcgaactcggcctggccttcgatggtgacggc
gaccgcctgggcctggtgaccaaggatggccagatcatctatccggaccgccagctcatg
ctcttcgccgaagacgtgctgacccgccatccgggcaaggaaatcctctacgacgtcaaa
tgcacccgccacctggcgccctggatcactgcgcgcggcggccggccgctgatgtggaag
accgggcattcgctggtcaaggccaagctgcgcgagaccggcgccccgctgggcggcgag
atgagcggccatatcttcttcaaggaccgctggttcggtttcgatgatggtctctatgcc
ggcgtacgcatgctggagctgatggcgcgccaggctgatccgtcggcagtgctcaatgcc
ttgccgcagtcggtgagcacgcctgaattgcagctcaagctgcaggaaggcgagaacgtg
gcgctcatcggcaaactgcagggcgaagccagtttcgaaggcgcccaggagatcatcgcc
atcgatggcctgcgcgtggaatatccggacggtttcggtctggcgcgctcgtccaacacc
acgccggtggtggtgttgcgcttcgaggcggaaacccccgaggcgctggcgcgcatccag
gcgcagttccgccaggccatcctggcggtgcggccagaggtggcattgccgttctga

DBGET integrated database retrieval system