KEGG   Herbaspirillum seropedicae: Hsero_0580Help
Entry
Hsero_0580        CDS       T01268                                 

Gene name
phoA
Definition
alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hsero_0580 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Hsero_0580 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hsero_0580 (phoA)
Enzymes [BR:hse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Hsero_0580 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
638054..639682
Genome map
AA seq 542 aa AA seqDB search
MPDQNPPADHSRRRFLRDSAVTTVTTAAALASPAALSATPAAPAIVTSERLRPQLPGGVM
SGDVTRDSAILWARADRNARMLVEYSTSGNFSNPVRIAGPTALAREDYTARVDLRDLPAG
QRLYYRVRFQDLVHESALSEPLTGSLMMPASAHGQARDITFAFSGDEAGQGWGINEQWGG
YRVYESMRRFRPDFFIHSGDQIYADGPIQAEVKLDDGSLWRNVVTEAKSKVAQTLDDYRG
NFAYNMLDANKRRFAAEVPFLVQWDDHEVRNNWYPGQEIGAAEKRYDERNIDVLAARARQ
AMFEHNPFRIDSADPFRIYRSFNHGPLLEVFMLDERSYRGRNSPNRQKGGHDADFLGPEQ
MRWIKQALLRSRSTWKLIASDMPLSIVVPDLNPDVPKGTFEAWANADNGKPSGRELEVAE
LLRFIKQHDIKNVVWVTADVHYASATHYAPERAQFTDFKPFWEFVGGPINAGTFGPGEID
RTFGPDVRFVSIPADMKQNRSPAELLQFFGIGKIDAKSKTLTVTLHNTDGKEIYKVELPP
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccagaacccgccagccgaccacagccgccgccgcttcctgcgcgacagtgcg
gtcaccaccgtcaccactgccgccgcgcttgccagcccggccgctttgtccgccaccccg
gccgcaccggccatcgtcacttccgaacgcctgcgcccgcaattgccgggcggcgtcatg
agcggggatgtcacccgcgacagcgccatcctctgggcgcgggccgaccgcaatgcccgc
atgctggtcgagtactcgaccagcgggaacttctccaaccccgtccgtatcgccggtccc
acggcgctggcgcgggaggactacaccgcccgcgtggacctgcgcgacttgcctgccggc
cagcgcctgtattaccgcgtgcgcttccaggacctggtgcatgagtcggcgctgagcgag
ccgctcaccggcagtctcatgatgccagcctcagcgcacggccaggcgcgtgacatcacc
tttgccttctcgggcgatgaagccggccagggctggggcatcaacgagcagtggggcggt
tatcgcgtgtacgaaagcatgcgccgcttccgtccggatttcttcatccattcgggtgac
cagatctatgccgatgggccgatccaggctgaagtgaagctggacgatggcagcctgtgg
cgcaatgtggtgaccgaagccaagtccaaggtagcgcagacgctggacgactatcgcggc
aacttcgcctacaacatgctggacgccaacaagcgccgtttcgccgccgaggtgccgttc
ctggtccagtgggacgaccacgaggtgcgcaacaactggtacccgggccaggagatcggc
gcggctgaaaagcgctacgacgaacgcaacatcgatgtgctggccgcccgtgcgcgccag
gccatgttcgaacacaatcccttccgcatcgacagcgccgatcctttccgcatctatcgc
tccttcaaccatgggccgctgctggaagtgttcatgctggatgagcgcagctatcgcggc
cgcaattcgcccaatcgccagaagggcgggcacgatgccgacttcctcggccccgagcag
atgcgctggattaagcaggcgctgctgcgttcgcgctcgacctggaagctgatcgccagc
gatatgccgctctccatcgtggtgccggacctgaacccggatgtgcccaaggggaccttc
gaagcctgggccaatgccgacaatggcaagccctccgggcgcgaactggaagtggccgag
ctgctgcgcttcatcaagcagcatgacatcaagaacgtggtctgggtgacggccgatgtg
cactacgcctcggccacgcactacgcaccggagcgggcccagttcaccgacttcaagccc
ttctgggaattcgtcggcgggccgatcaatgccggcaccttcggacctggcgagatcgat
cgcaccttcggtccggatgtgcgtttcgtcagcatcccggcggacatgaagcagaaccgc
tcaccggcggaactgctgcaattctttggcatcggcaagatcgatgcgaagagcaagacg
ctcaccgtcacgctgcacaacaccgacggcaaggagatctacaaggtggagttgccgccg
gaggcctga

DBGET integrated database retrieval system