KEGG   Herbaspirillum seropedicae SmR1: Hsero_0924Help
Entry
Hsero_0924        CDS       T01268                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00620  Pyruvate metabolism
hse00640  Propanoate metabolism
hse00680  Methane metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_0924 (acs)
   00620 Pyruvate metabolism
    Hsero_0924 (acs)
   00640 Propanoate metabolism
    Hsero_0924 (acs)
  Energy metabolism
   00680 Methane metabolism
    Hsero_0924 (acs)
Enzymes [BR:hse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hsero_0924 (acs)
Lipid biosynthesis proteins [BR:hse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hsero_0924 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADJ62441
UniProt: D8J0A4
Position
1006546..1008216
Genome map
AA seq 556 aa AA seqDB search
MPELIPAPRQPDYADVYAGFRIETLREQFQGDFETGINACVECCDRHVKGDNIALEFVSL
HGEHQQYSFAQVRSMAARVANLLRQQGIQPGQIVAGMLPRTPELLATVLGTLRAGAVYQP
LFTAFGPKAIEHRLALSGASLIVTNVANRDKLDEIANCPQVCTVRESNDPLRAGDIDFRA
AVDAQSDDFAPVLRSGADLMLMMSTSGTTGAAKGVPVPLSALQAFSVYMREAVGLLPQDK
FWNMADPGWAYGLYYAIIGPLAIGHGITFNEAAFTVSGTYETIRRLGITSLAGAPTAYRM
MMAAGEEAAASVKGRLRAVSSAGEPLNAEVVRWFASALDVPIHDHYGQTELGMVVNNHHA
LRHEVVPGSAGFAMPGYRVVVLDENHQELGANQPGELAIDIARSPLYWFSGYWKQDTPAI
AHGYYSTGDNVELEPNGSISFIGRSDDVITSAGYRIGPFDVESALLEHPAVADVAVIGLP
DPERTEIVKAFVVLSDQFKASDALREQLAQHVKRRLSAHAYPRAIEFLDALPKTPSGKLQ
RFVLRKMEADRRAGHP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttatccccgcgccgcgccagccggactatgcagacgtctatgcaggattt
cgcatcgagacgctgcgagagcagtttcaaggagacttcgagaccggcatcaatgcctgt
gtcgagtgctgtgaccggcatgtcaagggagataacatcgccctggagttcgtctccctg
catggcgagcatcaacagtacagttttgcgcaggtacgctcgatggcggcacgggtggcc
aatctgctcaggcagcaaggcatccagccgggccagatcgtggccgggatgctgccgcgc
acgccggagctgttggctacggtgctgggcacgctgcgcgccggcgcggtgtaccagccc
ctctttacggccttcggaccgaaggcgatagaacatcggctggcgctgagcggcgccagc
ctgatcgtcaccaatgtggccaaccgggataagctcgatgagattgccaattgtccccaa
gtctgcacggtcagggaaagcaacgatcccctgcgtgccggtgacatcgatttccgcgct
gctgtggacgcccagtcggatgacttcgcgccggtcctgcgcagcggcgccgacctgatg
ctcatgatgtccacctccggcaccacgggtgcggccaagggtgtgccggtgcccttgtcg
gcgctgcaggcgttctcggtctacatgcgcgaggcagtcggcttgctgccgcaggacaaa
ttctggaacatggccgatccgggctgggcctatggcctctattacgcgatcatcggcccg
ttggccatcggccacggcatcaccttcaacgaagccgcatttaccgtcagcgggacttac
gagaccatccgccgcctgggtatcaccagcctggccggtgcgcccacggcctatcgcatg
atgatggccgcaggcgaggaggccgccgccagtgtcaaaggcaggctgcgcgcggtcagc
agtgccggtgaaccattgaacgccgaggtggtgcgctggttcgccagcgccctggatgtc
cccatccatgaccattacggacagaccgagctgggcatggtggtcaacaaccatcacgcc
ttgcgacatgaggtcgtgccaggatcggccggctttgccatgccagggtatcgcgtcgtg
gtgctcgacgagaaccaccaggagcttggtgcgaaccagccaggcgagctggccatcgac
atcgcgagatcgccgctgtactggttttccggttactggaagcaggatacgcctgccatt
gcccacggctattactccactggcgacaacgtcgagctggagcccaacggcagcatcagt
ttcattggacgctccgacgatgtcattacctcggcgggctatcgtatcgggccgttcgat
gtcgaaagcgcactgctggagcacccggcggtggctgacgtggccgtcatcggcctgccg
gacccggagcgtaccgagatcgtcaaggccttcgtggtcctctcggaccagttcaaggcc
agcgatgcattgagggaacaattggcgcaacacgtcaaacggcgtctttccgcccacgcc
tatccacgcgccatcgagtttctcgacgccctgcccaagacgcccagcggcaagctgcag
cgtttcgtgctgcgcaagatggaggcggaccggcgcgctggccatccctga

DBGET integrated database retrieval system