KEGG   Herbaspirillum seropedicae: Hsero_0924Help
Entry
Hsero_0924        CDS       T01268                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hse01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hse00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hse00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hse00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hse00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006546..1008216
Genome map
AA seq 556 aa AA seqDB search
MPELIPAPRQPDYADVYAGFRIETLREQFQGDFETGINACVECCDRHVKGDNIALEFVSL
HGEHQQYSFAQVRSMAARVANLLRQQGIQPGQIVAGMLPRTPELLATVLGTLRAGAVYQP
LFTAFGPKAIEHRLALSGASLIVTNVANRDKLDEIANCPQVCTVRESNDPLRAGDIDFRA
AVDAQSDDFAPVLRSGADLMLMMSTSGTTGAAKGVPVPLSALQAFSVYMREAVGLLPQDK
FWNMADPGWAYGLYYAIIGPLAIGHGITFNEAAFTVSGTYETIRRLGITSLAGAPTAYRM
MMAAGEEAAASVKGRLRAVSSAGEPLNAEVVRWFASALDVPIHDHYGQTELGMVVNNHHA
LRHEVVPGSAGFAMPGYRVVVLDENHQELGANQPGELAIDIARSPLYWFSGYWKQDTPAI
AHGYYSTGDNVELEPNGSISFIGRSDDVITSAGYRIGPFDVESALLEHPAVADVAVIGLP
DPERTEIVKAFVVLSDQFKASDALREQLAQHVKRRLSAHAYPRAIEFLDALPKTPSGKLQ
RFVLRKMEADRRAGHP
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttatccccgcgccgcgccagccggactatgcagacgtctatgcaggattt
cgcatcgagacgctgcgagagcagtttcaaggagacttcgagaccggcatcaatgcctgt
gtcgagtgctgtgaccggcatgtcaagggagataacatcgccctggagttcgtctccctg
catggcgagcatcaacagtacagttttgcgcaggtacgctcgatggcggcacgggtggcc
aatctgctcaggcagcaaggcatccagccgggccagatcgtggccgggatgctgccgcgc
acgccggagctgttggctacggtgctgggcacgctgcgcgccggcgcggtgtaccagccc
ctctttacggccttcggaccgaaggcgatagaacatcggctggcgctgagcggcgccagc
ctgatcgtcaccaatgtggccaaccgggataagctcgatgagattgccaattgtccccaa
gtctgcacggtcagggaaagcaacgatcccctgcgtgccggtgacatcgatttccgcgct
gctgtggacgcccagtcggatgacttcgcgccggtcctgcgcagcggcgccgacctgatg
ctcatgatgtccacctccggcaccacgggtgcggccaagggtgtgccggtgcccttgtcg
gcgctgcaggcgttctcggtctacatgcgcgaggcagtcggcttgctgccgcaggacaaa
ttctggaacatggccgatccgggctgggcctatggcctctattacgcgatcatcggcccg
ttggccatcggccacggcatcaccttcaacgaagccgcatttaccgtcagcgggacttac
gagaccatccgccgcctgggtatcaccagcctggccggtgcgcccacggcctatcgcatg
atgatggccgcaggcgaggaggccgccgccagtgtcaaaggcaggctgcgcgcggtcagc
agtgccggtgaaccattgaacgccgaggtggtgcgctggttcgccagcgccctggatgtc
cccatccatgaccattacggacagaccgagctgggcatggtggtcaacaaccatcacgcc
ttgcgacatgaggtcgtgccaggatcggccggctttgccatgccagggtatcgcgtcgtg
gtgctcgacgagaaccaccaggagcttggtgcgaaccagccaggcgagctggccatcgac
atcgcgagatcgccgctgtactggttttccggttactggaagcaggatacgcctgccatt
gcccacggctattactccactggcgacaacgtcgagctggagcccaacggcagcatcagt
ttcattggacgctccgacgatgtcattacctcggcgggctatcgtatcgggccgttcgat
gtcgaaagcgcactgctggagcacccggcggtggctgacgtggccgtcatcggcctgccg
gacccggagcgtaccgagatcgtcaaggccttcgtggtcctctcggaccagttcaaggcc
agcgatgcattgagggaacaattggcgcaacacgtcaaacggcgtctttccgcccacgcc
tatccacgcgccatcgagtttctcgacgccctgcccaagacgcccagcggcaagctgcag
cgtttcgtgctgcgcaagatggaggcggaccggcgcgctggccatccctga

DBGET integrated database retrieval system