KEGG   Herbaspirillum seropedicae SmR1: Hsero_0926Help
Entry
Hsero_0926        CDS       T01268                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase (acetoacetyl-CoA thiolase) protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hsero_0926 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Hsero_0926 (atoB)
   00640 Propanoate metabolism
    Hsero_0926 (atoB)
   00650 Butanoate metabolism
    Hsero_0926 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_0926 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Hsero_0926 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hsero_0926 (atoB)
   00310 Lysine degradation
    Hsero_0926 (atoB)
   00380 Tryptophan metabolism
    Hsero_0926 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hsero_0926 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hsero_0926 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hsero_0926 (atoB)
Enzymes [BR:hse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hsero_0926 (atoB)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hsero_0926 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1009108..1010310
Genome map
AA seq 400 aa AA seqDB search
MSEDPVVIVSAARTAMGSFQGALADLPAPHLGAVAISAALQRAQLSAAQIAQIEQVWMGC
VLQAGLGQAPARQAALRAGLPQTVACATLNKVCGSAMQAVMLGHDSILAGSASMVVAGGM
ESMSNAPYLLPKARRGYRLGHDRLLDHMFLDGLEDAYSDQYRGRLMGTFAEDCASEFGFT
RAQQDAFAVQSTLRARQAISGGGFDWEVVPVDVAGKKGSVVISQDEGPMAVNLERIATLK
PAFSVDGTVTAANSSSISDGAAALLLMRESAALKQGLTPLARILGHASYAGAPEKFPTAP
IGVLRKIFAKTGLDAASTDLFEINEAFAVVPMAASRELDIDMEKINVHGGACALGHPIGA
SGARIIVSLLGALKARGLKTGIASLCIGGGEATAIALELS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagacccggttgtgattgtgtcggccgcccgtaccgcgatgggtagcttccag
ggagccctggctgatctgccggcgccacacctgggcgccgtggcgatatcggccgccctg
caacgtgcccagctatctgctgcccagatcgcgcagatcgagcaggtgtggatgggttgc
gtgctgcaggcaggcctgggccaggctcccgcacggcaggccgccttgcgtgccggtttg
ccgcagacggtagcctgcgctaccttgaacaaggtctgcggctcggccatgcaggccgtc
atgctggggcatgacagcatcctggccggttcggcgtcaatggtggtggccggcggcatg
gagtcgatgtccaatgccccgtatctgctccccaaggccagacggggttaccggcttggg
cacgacaggttgctggatcacatgttcctcgatggactggaggacgcctattcggaccag
tatcgcggtcgcctgatgggaaccttcgccgaggactgcgccagcgagttcggtttcacc
cgggcccagcaggatgcctttgcggtccagtccaccttgcgcgcgcgccaggcgatcagc
ggcggtggcttcgactgggaagtggttcctgtcgacgtggcgggaaagaagggcagcgtc
gtgatcagccaggatgaggggccgatggcggtgaacctggagcgcatcgccacgctcaaa
ccagccttcagtgtcgacggcacggtcactgccgccaattcctcttccatctctgacggc
gcagcggccttgctcctcatgcgcgaatcggcggcgctcaagcagggcttgacgcccttg
gccaggatcctgggccacgcctcgtatgccggtgcgcccgagaaattccccactgccccc
attggcgtgctgcgcaagatattcgccaagaccgggctggatgccgccagcacggacctg
tttgaaatcaacgaggcatttgcggtggtgcccatggcggccagccgggaactggacatc
gacatggagaagatcaatgtccacgggggcgcctgtgcgctaggacaccccatcggtgct
tccggggcgcgcatcatcgtgagcttgctgggagcgctcaaagcacgcgggctcaagaca
ggcatcgccagtctgtgcatcggcggcggcgaagcgaccgccatcgccctggagctgtca
tga

DBGET integrated database retrieval system