KEGG   Herbaspirillum seropedicae SmR1: Hsero_0964Help
Entry
Hsero_0964        CDS       T01268                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00071  Fatty acid degradation
hse00350  Tyrosine metabolism
hse00625  Chloroalkane and chloroalkene degradation
hse00626  Naphthalene degradation
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_0964 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_0964 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hsero_0964 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hsero_0964 (adhA)
   00626 Naphthalene degradation
    Hsero_0964 (adhA)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hsero_0964 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-ProteinID: ADJ62481
UniProt: D8J0S6
Position
complement(1057440..1058465)
Genome map
AA seq 341 aa AA seqDB search
MTQMMKAAVVREFGKPLSIEQVPVPTPAPGQILVKFEASGVCHTDLHAAHGDWPVKPTPP
FIPGHEGTGYVAAVGAGVKHVKEGDRVGVPWLHTACGCCSPCRTGWETLCAEQQNTGYSV
NGSFAEYGLADPKFVGHLPDNLDFGPAAPVLCAGVTVYKGLKETEVRPGEWVVISGIGGL
GHMAVQYAKAMGMHVVAADIHEDKLALAKKLGADLTVDGRNHNAVAEVQRIIGGAHGALV
TAVSPKAMEQAFGFLRARGTMALVGLPPGDISLPVFNTVLKRITVRGSIVGTRQDLEESL
VFAAEGKVAAHFTWDKLDNINAIFARMEEGKIDGRIVLDLK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatgatgaaagcggccgtcgtccgcgaattcggcaagcccctgtccatcgag
caagttcccgtccccacgcctgcgccgggccagatcctggtcaagttcgaagccagcggc
gtgtgccataccgacctgcacgcagcgcacggcgactggcccgtcaagcccacgcccccc
ttcattcccggccacgaaggcaccggctatgtcgccgccgtaggcgcgggcgtcaagcac
gtcaaggaaggcgaccgcgtcggcgtgccctggctgcacacggcctgcggctgctgctcg
ccctgccgcaccggctgggaaaccctgtgcgccgaacaacagaacaccggctattccgtc
aacggcagctttgccgaatacggcctggccgatcccaagttcgtcggtcacctgcccgac
aacctggacttcggccccgccgccccggtgctgtgcgccggcgtgaccgtctacaagggc
ttgaaggaaaccgaggtacgtcccggtgagtgggtcgtcatctccggcattggcggcctg
ggccacatggccgtgcaatacgccaaggccatgggcatgcacgtggtcgccgccgacatc
cacgaagacaagctggcgctggccaagaagctgggcgccgacctcaccgtcgatggccgc
aaccacaacgccgtggccgaagtccagcgcatcatcggcggcgcgcatggcgcgctggtc
acagcagtctcacccaaggcgatggaacaggccttcggcttcctgcgcgcacgtggcacc
atggcgctggtcggattgccgcccggcgacatcagcctgccggtgttcaacaccgtcttg
aagcgcatcaccgtgcgcggctccatcgtcggcacccgccaggatctggaagagtcgctg
gtcttcgccgccgaaggcaaggtcgctgcgcacttcacctgggacaagctggacaacatc
aatgccatctttgcgcggatggaagagggcaagattgatgggcggattgtgctggatctg
aagtaa

DBGET integrated database retrieval system