KEGG   Herbaspirillum seropedicae: Hsero_0964Help
Entry
Hsero_0964        CDS       T01268                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1 1.1.1.2)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Hsero_0964 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_0964 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_0964 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hsero_0964 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hsero_0964 (adhA)
   00626 Naphthalene degradation
    Hsero_0964 (adhA)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hsero_0964 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1057440..1058465)
Genome map
AA seq 341 aa AA seqDB search
MTQMMKAAVVREFGKPLSIEQVPVPTPAPGQILVKFEASGVCHTDLHAAHGDWPVKPTPP
FIPGHEGTGYVAAVGAGVKHVKEGDRVGVPWLHTACGCCSPCRTGWETLCAEQQNTGYSV
NGSFAEYGLADPKFVGHLPDNLDFGPAAPVLCAGVTVYKGLKETEVRPGEWVVISGIGGL
GHMAVQYAKAMGMHVVAADIHEDKLALAKKLGADLTVDGRNHNAVAEVQRIIGGAHGALV
TAVSPKAMEQAFGFLRARGTMALVGLPPGDISLPVFNTVLKRITVRGSIVGTRQDLEESL
VFAAEGKVAAHFTWDKLDNINAIFARMEEGKIDGRIVLDLK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatgatgaaagcggccgtcgtccgcgaattcggcaagcccctgtccatcgag
caagttcccgtccccacgcctgcgccgggccagatcctggtcaagttcgaagccagcggc
gtgtgccataccgacctgcacgcagcgcacggcgactggcccgtcaagcccacgcccccc
ttcattcccggccacgaaggcaccggctatgtcgccgccgtaggcgcgggcgtcaagcac
gtcaaggaaggcgaccgcgtcggcgtgccctggctgcacacggcctgcggctgctgctcg
ccctgccgcaccggctgggaaaccctgtgcgccgaacaacagaacaccggctattccgtc
aacggcagctttgccgaatacggcctggccgatcccaagttcgtcggtcacctgcccgac
aacctggacttcggccccgccgccccggtgctgtgcgccggcgtgaccgtctacaagggc
ttgaaggaaaccgaggtacgtcccggtgagtgggtcgtcatctccggcattggcggcctg
ggccacatggccgtgcaatacgccaaggccatgggcatgcacgtggtcgccgccgacatc
cacgaagacaagctggcgctggccaagaagctgggcgccgacctcaccgtcgatggccgc
aaccacaacgccgtggccgaagtccagcgcatcatcggcggcgcgcatggcgcgctggtc
acagcagtctcacccaaggcgatggaacaggccttcggcttcctgcgcgcacgtggcacc
atggcgctggtcggattgccgcccggcgacatcagcctgccggtgttcaacaccgtcttg
aagcgcatcaccgtgcgcggctccatcgtcggcacccgccaggatctggaagagtcgctg
gtcttcgccgccgaaggcaaggtcgctgcgcacttcacctgggacaagctggacaacatc
aatgccatctttgcgcggatggaagagggcaagattgatgggcggattgtgctggatctg
aagtaa

DBGET integrated database retrieval system