KEGG   Herbaspirillum seropedicae: Hsero_0973Help
Entry
Hsero_0973        CDS       T01268                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hse00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067707..1069194
Genome map
AA seq 495 aa AA seqDB search
MAYLLALDQGTSSSRSIIFDQSGAIVATAQQEFPQIFPQPGWVEHDPMDLWHSQLQTAQK
VLAQSGIKASELTALGITNQRETTVVWERATGKPVYNAVVWQDRRAEVVCAALRERGLGE
AIQKKTGLVLDPYFSGTKLRWILDHVDGLRARAERGELLFGTVDSWLVWNLTGGRLHVSD
VSNASRTMLWNIHTGAWDEELLQWLGIPAAMLPQVQPSAHLYGEIDAQHLGAAVKIGGIA
GDQQSALFGQACVRPGMAKNTYGTGCFMLLHTGDQCATSHNGLISTAACQVDEQKQYALE
GSVFIGGAVVQWLRDGLKAIKTSTDVEGLACSVEDSGGVVFVPSFTGLGAPYWNPSAKGA
IVGLSRGSTVAHIARAALESIAFQSTALLNAMVRDAVSPITELRVDGGAAANNLLLQFQA
DLLGIPVIRPQVTETTALGAAYLAGIATGVYRDLSELSSQWRMEHTFEPSIGRDQAQARI
HAWEAAIRQVSAGQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcttatctgctcgccctcgaccagggaacctccagctcgcgcagcatcatcttcgac
cagagcggcgccatcgtggcgaccgcccagcaggaatttccgcagatctttccccagccc
ggctgggtggaacacgatcccatggacctgtggcacagccagctgcagaccgcgcagaag
gtgctggcgcaaagcggcatcaaggccagcgaactgactgccctgggcatcaccaaccag
cgcgagaccaccgtggtgtgggagcgcgccaccggcaagccggtctacaacgccgtggtc
tggcaggatcgccgcgccgaagtggtctgcgcggcattgcgtgagcgcggcctgggcgag
gccatccagaagaagaccgggctggtgcttgatccctatttttccggcaccaagctgcgc
tggatcctggaccacgtcgatggcctgcgcgcccgcgccgagcgcggcgagctgctgttc
ggcaccgtcgattcctggctggtgtggaacctgacgggcggccgtctgcacgtgagcgat
gtgtccaatgcgtcgcgcaccatgctgtggaatatccataccggcgcctgggatgaggaa
ttgctgcaatggctgggcattcccgccgcgatgctgccgcaggtgcagccctcggcgcat
ctctatggcgagatcgatgcgcagcacctgggcgcggccgtgaagatcggcggcatcgcc
ggcgaccagcagtcggccctgttcggccaggcctgcgtgcgtcctggcatggccaagaat
acctatggcaccggctgcttcatgctgctgcataccggcgaccagtgcgccacctcgcac
aatggcctcatcagcacggcggcctgccaggtcgatgagcagaaacaatatgcgctggaa
ggcagcgtcttcatcggcggtgcagtggtgcagtggctgcgcgatggcttgaaggccatc
aagacctccaccgacgtcgaaggcctggcctgctcggtggaagattcgggtggggtggtg
ttcgtgccgtccttcaccggactgggcgcgccttactggaatccttcggccaagggcgcc
atcgtcggcctgagccggggcagcacggtggcgcacatcgcccgcgcggcgctggagtcg
atcgccttccagagcacggcgctgctcaatgccatggtgcgcgatgccgtctcaccgatc
accgagctgcgcgtggatggcggggcggcggccaacaacctgttgctgcagttccaggcc
gacctgctgggcatcccggtgatccgtccgcaggtcaccgagaccacggccctgggtgca
gcctacctggctggtatcgccacgggcgtctatcgcgatctgtccgagctgtcctcgcaa
tggcgcatggaacataccttcgaacccagcatcgggcgcgaccaggcgcaggcgcgcatc
cacgcctgggaggcggcgatccgccaggtcagcgccggtcaggcttga

DBGET integrated database retrieval system