KEGG   Herbaspirillum seropedicae: Hsero_1064Help
Entry
Hsero_1064        CDS       T01268                                 

Gene name
rbsC
Definition
(GenBank) ABC-type ribose/xylose/arabinose/galactoside transport system, permease component protein
  KO
K10440  
ribose transport system permease protein
Organism
hse  Herbaspirillum seropedicae
Pathway
ABC transporters
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:hse00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Hsero_1064 (rbsC)
Transporters [BR:hse02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    Hsero_1064 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1177238..1178224
Genome map
AA seq 328 aa AA seqDB search
MPHDANALPAASLHTAASARWRSLIHSPLALPLAGLVVVSLLMGLASDNFFTLSNWFNVL
RQVSIVGILAVGMSFVILTGGIDLSVGAAMALAGTISAGLIVNSGLPAPLALLCGVGLAT
CIGLLNGALVAWGRMPAIIVTLATMGVARGVGLIYSGGYPISGLPGWISWFGVGRIGMVP
VPVILMLIVYALAWLLLQRTAFGRHVYAIGGNEMAARLSGVKTTRIKLAVYAISGFTSGL
AAIILTGRLMSGQPNAGVGFELDAIAAVVLGGTAIAGGRGLVVGTLIGAVLLGILNNGLN
LMGINPYLQDIIRGVIILLAIYIAREWR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatgacgccaacgcactgcccgcagcctcgctgcacaccgccgccagcgcccgc
tggcgcagcctgatccattcgccgctggcgctgcccttggccgggctggtggtggtgtcg
ctgctcatggggctggcctcggacaatttcttcaccctctccaactggttcaatgtgctg
cgccaggtgtccatcgtcggcatcctggccgtgggcatgagctttgtcatcctcactggc
ggcatcgatctctcggtgggcgcggccatggcgctggccggcacgatctcggccggactc
atcgtcaacagcggcctgcccgcgccgctggcgttgctgtgcggtgtcggactggccacc
tgcatcggcctgctcaatggcgcactggtggcgtgggggcgcatgccagccatcatcgtc
acgctggccaccatgggcgtggcgcgcggagtggggctgatctattcgggcggctatccg
atctcgggtctgccgggctggatctcgtggtttggcgtgggtcgcatcggcatggtgcca
gtgccggtgatcctgatgctgatcgtctatgcactggcctggctgttgctgcagcggacc
gcctttggccgccatgtctacgccatcggcggcaatgagatggcggcgcgcctgtcgggc
gtgaagaccacgcgcatcaagctggcggtgtatgccatttccggcttcacctcgggcttg
gccgcgatcatcctgacgggccggctcatgtcgggccagcccaatgcgggcgtgggcttc
gaactggatgcgattgccgccgtggtgctgggcggcaccgccatcgccggagggcgcggg
ctggtggtgggcacgctcatcggcgcggtgctgctgggcatcctcaacaatggcctgaac
ctgatgggcatcaatccctacctgcaagacatcattcgcggcgtgatcatcctgctggcg
atctatatcgcacgggaatggcgctga

DBGET integrated database retrieval system