KEGG   Herbaspirillum seropedicae: Hsero_1175Help
Entry
Hsero_1175        CDS       T01268                                 

Definition
guanyl-specific ribonuclease Sa protein (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
hse  Herbaspirillum seropedicae
Brite
Enzymes [BR:hse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Hsero_1175
Transfer RNA biogenesis [BR:hse03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Hsero_1175
 Prokaryotic Type
    Hsero_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342022..1342417
Genome map
AA seq 131 aa AA seqDB search
MRARFIFSIFSRYWLVLLTALMLSAPVQARGPAPGGLPEVNLDQLPREAQQTMALIRAGG
PFPYEKDGAVFGNYEGVLPRQKRGYYREYTVKTPRARNRGARRIVSGGEPKTSGEYYYTS
DHYKTFRRIRD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcccgattcattttctcgatattttcccgctactggctggtgctgttgaccgcc
ctgatgctgtcggcgccggtgcaggcgcgcggacctgcgccggggggcttgccggaggtc
aaccttgaccagctgccgcgcgaagcccagcagaccatggccctgatccgcgccggcgga
cctttcccctacgagaaggatggagcggtgttcggcaattacgaaggggtgttgcccagg
caaaagcgcgggtattatcgcgaatacaccgtcaagacgccgcgcgcacgcaatcgcggg
gcccgcaggatcgtcagcggaggggagcccaagacttccggcgaatactattacaccagc
gatcactacaagaccttccgccggatacgggattga

DBGET integrated database retrieval system