KEGG   Herbaspirillum seropedicae: Hsero_1246Help
Entry
Hsero_1246        CDS       T01268                                 

Definition
beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hse  Herbaspirillum seropedicae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hse00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hse00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1411900..1412682)
Genome map
AA seq 260 aa AA seqDB search
MLLKDKVALITGSASGIGKEIAVEYARQGAKVVIADLALEAAKATAEEIVKEGGTAMAVA
MNVTDETQVDKGVADAVNTYGGLDIMISNAGIQIISPVAELSLENWRKMLAIHLDGAFLT
TRAAMKAMIKQGRGGSIIYMGSVHSHLASPLKAPYVTAKHGLLGLAKTVAKEGAKDKIRT
NVICPGFVRTPLVEKQIPEQAKEFGISEEDVIKKIMLKDTVDGEFTTTQDVAQTAVFLAA
FPTNALTGQSVVVSHGWHMQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctactcaaggataaagtcgctctcatcaccggttcggccagcggcatcggcaaggaa
atcgccgtcgagtacgcccgccagggcgccaaggtcgtcatcgccgacctggccctggaa
gccgccaaggccaccgccgaggaaatcgtcaaggaaggcggcaccgccatggccgtggcc
atgaacgtcaccgatgaaacccaggtcgacaagggtgtggccgatgcggtcaacacctac
ggcgggctggacatcatgatcagcaatgccggcattcagatcatcagcccggtggccgaa
ctgtcgctggagaactggcgcaagatgctggcgatccacctggacggcgccttcctgacc
acccgcgcggccatgaaggccatgatcaagcagggccgcggcggctccatcatctacatg
ggctcggtccactcgcacctggcctcgccgctgaaggctccctatgtcacggccaagcat
ggcttgctgggcctggccaagacggtggccaaggaaggcgccaaggacaagatccgcacc
aatgtcatctgccccggcttcgtccgcaccccgctggtggaaaagcagattcccgagcag
gccaaggaattcggtatcagcgaagaagacgtgatcaagaagatcatgctcaaggacacc
gtcgatggcgaattcaccaccacccaggacgtggcccaaaccgccgtcttcctggcggcc
ttcccgaccaatgctctgaccggccagtcggtggtggtcagccacggctggcatatgcag
taa

DBGET integrated database retrieval system