KEGG   Herbaspirillum seropedicae: Hsero_1470Help
Entry
Hsero_1470        CDS       T01268                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hse00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1691889..1692827)
Genome map
AA seq 312 aa AA seqDB search
MSLIDEQEVPPDLPHIQRIEVNQLQCLRVQTARAELLIAEQGAQVLRYQEHGQEPLIWMS
EEAAFEAGNSVRGGIPVCWPWFGDLMRNPPQVQSLHSGGRLPAHGLVRGIPWLLMENAIE
GDSVRLVLAIPPTSESPALRHLPPGIELRLEILLDDRLHLKLTTRNGSEQHLALTQALHS
YFAVSSIHDVTIEGLEGHRYIETLEGWAEREQKRALVVSSETDRIYLDLPPRLSIRDDGW
NRRIQIEASGSTSAVVWNPWVSKARRLSQFADDAWQRMLCVETANVMEDLVELEPGAEHT
LGVTLWSEKAGG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcgacgaacaggaagtcccgcccgatcttccccacatccagcgcatcgaa
gtcaaccagctgcagtgcctgcgcgtgcagactgcgcgggcagaactgctcattgccgaa
cagggcgcgcaggtgctgcgctaccaggagcatggacaggaaccgctgatctggatgagc
gaagaagccgccttcgaggccggcaactcggtgcgcggcgggattcccgtctgctggccc
tggttcggcgacctgatgcgcaacccgccgcaggtacaatcgctgcactcgggcggccgc
ctgcccgcgcacggtctggtgcgcggcattccctggctgctgatggagaacgccatcgag
ggcgacagcgtgcgcctggtgctggccatcccgcccaccagcgaatcgccggcgctgcgc
cacctgccgccgggcatcgagctgcgcctggagatcctgctggacgaccgcctgcacctc
aagctcaccacccgcaatggcagcgagcagcatctcgccctcacgcaggcgctgcatagc
tatttcgccgtcagcagcatccacgacgtcaccatcgaaggcctggaaggccaccgctat
atcgagaccctggaaggctgggccgagcgcgagcagaagcgcgccctggtggtcagcagc
gaaaccgaccgcatctacctggacctgccgccgcgcctgtccatccgcgacgatggctgg
aaccgccgcatccagatcgaggccagcggctcgacctcggcggtggtctggaacccctgg
gtgagcaaggcgcgccggctgtcacagttcgccgatgacgcctggcaacgcatgctgtgc
gtggaaacggccaacgtgatggaagacctggtggaactggagcccggcgccgagcacacc
ctgggcgtgacgctctggagcgagaaagcgggcggctga

DBGET integrated database retrieval system