KEGG   Herbaspirillum seropedicae SmR1: Hsero_1470Help
Entry
Hsero_1470        CDS       T01268                                 

Definition
(GenBank) aldose 1-epimerase protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_1470
Enzymes [BR:hse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Hsero_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADJ62985
UniProt: D8IPG5
Position
complement(1691889..1692827)
Genome map
AA seq 312 aa AA seqDB search
MSLIDEQEVPPDLPHIQRIEVNQLQCLRVQTARAELLIAEQGAQVLRYQEHGQEPLIWMS
EEAAFEAGNSVRGGIPVCWPWFGDLMRNPPQVQSLHSGGRLPAHGLVRGIPWLLMENAIE
GDSVRLVLAIPPTSESPALRHLPPGIELRLEILLDDRLHLKLTTRNGSEQHLALTQALHS
YFAVSSIHDVTIEGLEGHRYIETLEGWAEREQKRALVVSSETDRIYLDLPPRLSIRDDGW
NRRIQIEASGSTSAVVWNPWVSKARRLSQFADDAWQRMLCVETANVMEDLVELEPGAEHT
LGVTLWSEKAGG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcatcgacgaacaggaagtcccgcccgatcttccccacatccagcgcatcgaa
gtcaaccagctgcagtgcctgcgcgtgcagactgcgcgggcagaactgctcattgccgaa
cagggcgcgcaggtgctgcgctaccaggagcatggacaggaaccgctgatctggatgagc
gaagaagccgccttcgaggccggcaactcggtgcgcggcgggattcccgtctgctggccc
tggttcggcgacctgatgcgcaacccgccgcaggtacaatcgctgcactcgggcggccgc
ctgcccgcgcacggtctggtgcgcggcattccctggctgctgatggagaacgccatcgag
ggcgacagcgtgcgcctggtgctggccatcccgcccaccagcgaatcgccggcgctgcgc
cacctgccgccgggcatcgagctgcgcctggagatcctgctggacgaccgcctgcacctc
aagctcaccacccgcaatggcagcgagcagcatctcgccctcacgcaggcgctgcatagc
tatttcgccgtcagcagcatccacgacgtcaccatcgaaggcctggaaggccaccgctat
atcgagaccctggaaggctgggccgagcgcgagcagaagcgcgccctggtggtcagcagc
gaaaccgaccgcatctacctggacctgccgccgcgcctgtccatccgcgacgatggctgg
aaccgccgcatccagatcgaggccagcggctcgacctcggcggtggtctggaacccctgg
gtgagcaaggcgcgccggctgtcacagttcgccgatgacgcctggcaacgcatgctgtgc
gtggaaacggccaacgtgatggaagacctggtggaactggagcccggcgccgagcacacc
ctgggcgtgacgctctggagcgagaaagcgggcggctga

DBGET integrated database retrieval system