KEGG   Herbaspirillum seropedicae: Hsero_1718Help
Entry
Hsero_1718        CDS       T01268                                 

Gene name
speB
Definition
arginase/agmatinase/formimionoglutamate hydrolase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hse  Herbaspirillum seropedicae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hsero_1718 (speB)
Enzymes [BR:hse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Hsero_1718 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948440..1949393
Genome map
AA seq 317 aa AA seqDB search
MEHALYQPLGGNVMPRFGGIATMMRLPHVEDPAGLDVGFVGVPLDIGTSNRSGTRFGPRQ
IRTESVLLRPYNMATRAAPFDSLKVADLGDVALNPYSLLDSVRMIEEAYDRIYATGCKTI
SLGGDHTLTLPILRALARYRGPVGLIHVDAHADVNDTMNGEKIAHGTPFRRAFEEGLLDP
QRVVQIGLRGTGYHADDFDWCRAQGFRVVQAEECWHRSLAPLMEEVRAQMGDGPVYLTFD
IDGLDPAFAPGTGTPEIGGLTVQQGLEIIRGCKGLDIVSADVVEVSPPYDQAGTTALVAA
NLAYEMLCILPGVTYRT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgcactttaccaacctctcgggggcaacgtgatgccccgttttggcggcatc
gccaccatgatgcgattgccgcatgtggaagatccggccgggctggatgtgggttttgtc
ggcgtgccgctggacatcggcacctccaaccgttccggtacgcgcttcgggccacgccag
atccgcacggaatccgtgctgctgcgcccctacaacatggccacccgcgccgcgcctttc
gattcgctgaaggtggctgacctgggcgacgtggccttgaatccgtacagcctgctggat
tcggtgcgcatgatcgaagaggcctatgaccgcatctacgccaccggctgcaagaccatc
agcctgggcggcgaccacaccctgacactccccatcctgcgcgccctggcgcgctatcgc
ggcccggtagggctgatccatgtggatgcccatgccgacgtcaacgacaccatgaacggc
gagaagatcgcccacggcacaccgttccgccgcgccttcgaggagggcttgctggacccg
cagcgggtggtgcagatcggtttgcgcggcaccggctatcatgccgatgacttcgactgg
tgccgcgcccagggttttcgcgtggtgcaggccgaagaatgctggcatcgttcgctggcg
ccgttgatggaagaggtgcgcgcgcagatgggcgatggcccggtctacctgacctttgat
atcgacggcttggaccccgcctttgcacccggcaccggcacgccggaaattggcgggctg
acggtgcagcagggactggagatcatccgtggctgcaagggactcgatatcgtttcggcc
gatgtggtcgaggtttcgcctccctatgaccaggccggaaccaccgcgctggtggcggct
aacctggcctatgagatgttgtgcatcctgccgggcgtgacataccggacctga

DBGET integrated database retrieval system