KEGG   Herbaspirillum seropedicae: Hsero_1765Help
Entry
Hsero_1765        CDS       T01268                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hsero_1765 (tpiA)
   01230 Biosynthesis of amino acids
    Hsero_1765 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_1765 (tpiA)
   00051 Fructose and mannose metabolism
    Hsero_1765 (tpiA)
   00562 Inositol phosphate metabolism
    Hsero_1765 (tpiA)
Enzymes [BR:hse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hsero_1765 (tpiA)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hsero_1765 (tpiA)
  Exosomal proteins of bladder cancer cells
   Hsero_1765 (tpiA)
  Exosomal proteins of melanoma cells
   Hsero_1765 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996548..1997297
Genome map
AA seq 249 aa AA seqDB search
MRRKLVAGNWKMNGSLAANAALVAGIKEGLAAQACDVAVCVPAPYLAQVQALVAGSPVGL
GAQDMSAHASGAYTGEVSASMLQEFGVQYVILGHSERRAYHGESDAAVAAKTVAALKAGL
VPLVCVGETLEQREAGQTNAVVGGQLDVVLAALSAEEAARIVVAYEPVWAIGTGKTATPE
MAQEVHAMLRARLGAKSAEAAAKVCILYGGSMKPDNAQQLLAMGDIDGGLIGGAALKAAD
FLAIINAAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaaacttgtagccggtaactggaaaatgaatggcagcctggctgccaatgct
gccctggtggccggcatcaaggaagggctcgcggcccaggcttgcgatgtggccgtctgc
gtgccggcgccttacctggcgcaggtgcaggcgcttgtggccggttcgccggtggggctg
ggtgcgcaggatatgtccgcccatgcttcgggcgcctataccggcgaggtgtcggcatcc
atgttgcaggaattcggtgtgcagtacgtcatcctgggtcactccgagcgtcgcgcctat
catggcgagtccgatgcagcggtggcggccaagacggtggctgcgctcaaggccgggtta
gtgccgctggtgtgtgtgggcgagacgctggagcagcgtgaagccggccagaccaatgcc
gtcgtgggtggtcagctcgatgtcgtgctggctgcgctgagcgcggaagaggctgcccgc
atcgtcgtggcttatgagccggtctgggcaatcggcaccggcaagaccgctacgcccgag
atggcgcaggaagtgcatgcgatgttgcgcgcgcgtctgggcgccaagagcgcggaagct
gctgccaaggtatgcatcctgtacggcggcagcatgaagcccgataatgcccagcagttg
ctggccatgggtgacatcgatgggggtctcatcggtggtgcggcgttgaaggcggcggat
ttcctcgcgatcatcaatgcggcggcctga

DBGET integrated database retrieval system