KEGG   Herbaspirillum seropedicae SmR1: Hsero_1765Help
Entry
Hsero_1765        CDS       T01268                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hse  Herbaspirillum seropedicae SmR1
Pathway
hse00010  Glycolysis / Gluconeogenesis
hse00051  Fructose and mannose metabolism
hse00562  Inositol phosphate metabolism
hse01100  Metabolic pathways
hse01110  Biosynthesis of secondary metabolites
hse01120  Microbial metabolism in diverse environments
hse01130  Biosynthesis of antibiotics
hse01200  Carbon metabolism
hse01230  Biosynthesis of amino acids
Module
hse_M00002  Glycolysis, core module involving three-carbon compounds
hse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_1765 (tpiA)
   00051 Fructose and mannose metabolism
    Hsero_1765 (tpiA)
   00562 Inositol phosphate metabolism
    Hsero_1765 (tpiA)
Enzymes [BR:hse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hsero_1765 (tpiA)
Exosome [BR:hse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hsero_1765 (tpiA)
  Exosomal proteins of bladder cancer cells
   Hsero_1765 (tpiA)
  Exosomal proteins of melanoma cells
   Hsero_1765 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CUTL
Motif
Other DBs
NCBI-ProteinID: ADJ63278
UniProt: D8IRF4
Position
1996548..1997297
Genome map
AA seq 249 aa AA seqDB search
MRRKLVAGNWKMNGSLAANAALVAGIKEGLAAQACDVAVCVPAPYLAQVQALVAGSPVGL
GAQDMSAHASGAYTGEVSASMLQEFGVQYVILGHSERRAYHGESDAAVAAKTVAALKAGL
VPLVCVGETLEQREAGQTNAVVGGQLDVVLAALSAEEAARIVVAYEPVWAIGTGKTATPE
MAQEVHAMLRARLGAKSAEAAAKVCILYGGSMKPDNAQQLLAMGDIDGGLIGGAALKAAD
FLAIINAAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaaacttgtagccggtaactggaaaatgaatggcagcctggctgccaatgct
gccctggtggccggcatcaaggaagggctcgcggcccaggcttgcgatgtggccgtctgc
gtgccggcgccttacctggcgcaggtgcaggcgcttgtggccggttcgccggtggggctg
ggtgcgcaggatatgtccgcccatgcttcgggcgcctataccggcgaggtgtcggcatcc
atgttgcaggaattcggtgtgcagtacgtcatcctgggtcactccgagcgtcgcgcctat
catggcgagtccgatgcagcggtggcggccaagacggtggctgcgctcaaggccgggtta
gtgccgctggtgtgtgtgggcgagacgctggagcagcgtgaagccggccagaccaatgcc
gtcgtgggtggtcagctcgatgtcgtgctggctgcgctgagcgcggaagaggctgcccgc
atcgtcgtggcttatgagccggtctgggcaatcggcaccggcaagaccgctacgcccgag
atggcgcaggaagtgcatgcgatgttgcgcgcgcgtctgggcgccaagagcgcggaagct
gctgccaaggtatgcatcctgtacggcggcagcatgaagcccgataatgcccagcagttg
ctggccatgggtgacatcgatgggggtctcatcggtggtgcggcgttgaaggcggcggat
ttcctcgcgatcatcaatgcggcggcctga

DBGET integrated database retrieval system