KEGG   Herbaspirillum seropedicae: Hsero_1765Help
Entry
Hsero_1765        CDS       T01268                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hse01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hse01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hse00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hse00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hse00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996548..1997297
Genome map
AA seq 249 aa AA seqDB search
MRRKLVAGNWKMNGSLAANAALVAGIKEGLAAQACDVAVCVPAPYLAQVQALVAGSPVGL
GAQDMSAHASGAYTGEVSASMLQEFGVQYVILGHSERRAYHGESDAAVAAKTVAALKAGL
VPLVCVGETLEQREAGQTNAVVGGQLDVVLAALSAEEAARIVVAYEPVWAIGTGKTATPE
MAQEVHAMLRARLGAKSAEAAAKVCILYGGSMKPDNAQQLLAMGDIDGGLIGGAALKAAD
FLAIINAAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaaacttgtagccggtaactggaaaatgaatggcagcctggctgccaatgct
gccctggtggccggcatcaaggaagggctcgcggcccaggcttgcgatgtggccgtctgc
gtgccggcgccttacctggcgcaggtgcaggcgcttgtggccggttcgccggtggggctg
ggtgcgcaggatatgtccgcccatgcttcgggcgcctataccggcgaggtgtcggcatcc
atgttgcaggaattcggtgtgcagtacgtcatcctgggtcactccgagcgtcgcgcctat
catggcgagtccgatgcagcggtggcggccaagacggtggctgcgctcaaggccgggtta
gtgccgctggtgtgtgtgggcgagacgctggagcagcgtgaagccggccagaccaatgcc
gtcgtgggtggtcagctcgatgtcgtgctggctgcgctgagcgcggaagaggctgcccgc
atcgtcgtggcttatgagccggtctgggcaatcggcaccggcaagaccgctacgcccgag
atggcgcaggaagtgcatgcgatgttgcgcgcgcgtctgggcgccaagagcgcggaagct
gctgccaaggtatgcatcctgtacggcggcagcatgaagcccgataatgcccagcagttg
ctggccatgggtgacatcgatgggggtctcatcggtggtgcggcgttgaaggcggcggat
ttcctcgcgatcatcaatgcggcggcctga

DBGET integrated database retrieval system