KEGG   Herbaspirillum seropedicae: Hsero_1941Help
Entry
Hsero_1941        CDS       T01268                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hse  Herbaspirillum seropedicae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_1941
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Hsero_1941
Enzymes [BR:hse01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Hsero_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197278..2198306
Genome map
AA seq 342 aa AA seqDB search
MNQAVKPLGPVMLDVVGTRLEAADIARLQHPLTGGVILFARNYESRAQLVALTSAIRQAR
PGILIAVDHEGGRVQRFRTDGFTRLPAMGQLGQLWDRDVLQATKVATATGFVLAAELRAC
GIDLSFTPVLDLDYGASTVIGDRSFHRDPRVVTLMAKSLNHGLALAGMANCGKHFPGHGF
VTADSHVAIPVDERELDEILGDDATPYDWLGMSLAAVMPAHVIYPKVDAQPAGFSKVWLS
MLRERFGFQGVIFSDDLSMHGASVAGGPLEAAQAALDAGCDVALICNSPDKADAILAGLQ
GGTDAASAARRATLLPCGEALAWDALQADPRYLAARALVQSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagccgtcaaaccgctcggtccggtgatgctggacgtggtcggcacccggctg
gaggcggccgatatcgcccgcctccagcatccgctgaccggcggggtcatcctgtttgcc
cgcaattacgaaagccgtgcgcaactggtcgccctgaccagcgcgatccgccaggcccgt
cccggcatcctcatcgccgtggaccatgaaggagggcgcgtgcagcgcttccgcaccgat
ggcttcacgcgcctgcctgccatgggccagctcggccagctgtgggaccgcgacgtgctg
caggccaccaaggtagccactgccaccggcttcgtgctggccgctgaactgcgcgcctgc
ggcatcgatttgtcgttcacgccggtgctcgatctcgattacggagcctccaccgtcatc
ggtgaccgctccttccatcgtgatccacgcgtggtcacactgatggccaagagcctcaat
cacggcctggcgctggcgggcatggccaattgcggcaagcatttccctggtcacggtttc
gtcacggccgattcgcatgtggccatcccggtggacgagcgcgagctcgacgagatcctc
ggcgacgacgccacgccttacgactggctgggcatgagcctggctgccgtgatgccggcg
cacgtcatctatcccaaggtggatgcgcagccggcaggcttctccaaggtctggctgtcc
atgctgcgcgagcgcttcggtttccagggcgtgatcttcagcgacgacctcagcatgcat
ggcgccagtgtcgccggtggcccgctggaggccgcgcaggctgcgctggatgcgggctgt
gacgtggccctcatctgcaactcgccggacaaggccgatgccatcctggcaggcttgcag
ggcggcacggatgcagcctcggctgcgcgtcgcgccaccttgctgccctgtggcgaggcg
ttggcgtgggacgcgctgcaggccgacccgcgttatctggctgcgcgcgcgctggtgcag
tcgctgtaa

DBGET integrated database retrieval system