KEGG   Herbaspirillum seropedicae: Hsero_2096Help
Entry
Hsero_2096        CDS       T01268                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hsero_2096 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hsero_2096 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hsero_2096 (thrC)
Enzymes [BR:hse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hsero_2096 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2355671..2357131
Genome map
AA seq 486 aa AA seqDB search
MQYVSTRGHAATPSFSEILLGGLAPDGGLYLPAQYPQVSGAELDQWRKLSYADLAFEVLR
KFATDIPEADLKALAHKTYTADVYRNTRAGEHAAEITPLRTLEEQGGKKLVLQSLSNGPT
LAFKDMAMQLLGNLFEYALAKQGAELNIVGATSGDTGSAAEYAMRGKKGIRVFMLSPHKK
MSAFQTAQMFSLQDPNIFNLAIEGVFDDCQDIVKAISNDLEYKAAKKIGTVNSINWARVV
AQVVYYFRGYLAATTSNEQKVSFTVPSGNFGNICAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGIYRVRKSAETYHTSSPSMDISKASNFERFVYDLLGRDSARVKDLFHKVETAGGF
DLSGQAGSDGNEFTSVIQYGFASGRSTHADRLETIRFAEKTYGITVDTHTADGIKVAREH
LTPGVTMIVLETALPAKFNETIREALGRDADRPAGFENIEALPQRFEVMPADAARVKAYV
AQHTGL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgtctccacccgcggtcacgctgcaacaccttccttctccgaaatcctgctg
ggtggcctggccccggacggtggcctgtacctgccggcgcagtacccccaggtcagcggc
gccgaactggaccagtggcgcaagctgtcctatgccgacctggccttcgaggtgctgcgc
aagttcgccaccgacatccccgaggccgacctcaaggcgctggcgcacaagacctatacc
gccgacgtctatcgcaatacccgcgccggcgaacatgcggccgagatcacgccgctgcgc
acgctggaagagcagggtggcaagaagctggtgctgcagagcctgtccaacggccccacg
ctggccttcaaggacatggccatgcaactgctgggcaacctgttcgaatacgcgctggcc
aagcagggcgcggaattgaatatcgtcggcgccacctccggcgacaccggcagcgccgct
gaatacgccatgcgcggcaagaagggcatccgcgtcttcatgctgtcgccacacaagaag
atgagcgccttccagaccgcgcagatgttcagcctgcaagaccccaacatcttcaacctg
gccatcgaaggcgtcttcgatgactgccaggacatcgtcaaggccatctccaacgacctg
gagtacaaggccgccaagaagatcggcaccgtcaactcgatcaattgggcgcgcgtggtg
gcccaggtggtgtactacttccgtggctacctggccgcgaccaccagcaatgaacagaag
gtgtccttcaccgtcccctcgggcaacttcggcaacatctgcgccggccacatcgcccgc
atgatgggcctgcccatcgacaagctggtggtggccaccaacgagaacgacgtgctcgac
gaattcttccgcaccggcatctaccgcgtgcgcaagtcggccgagacctaccacaccagc
agccccagcatggacatcagcaaggcctccaacttcgagcgcttcgtctatgacctgctg
ggccgcgacagcgcccgcgtcaaggacctgttccacaaggtcgagaccgcaggcggcttc
gacctgagcggccaggccggcagcgacggcaacgaattcaccagcgtgatccagtatggc
tttgcctcgggcaggtccacccacgccgaccgcctggagaccatccgcttcgctgaaaag
acctacggcatcacggtcgatacccacaccgccgacggcatcaaggtggcgcgcgagcat
ctcacgccgggcgtgaccatgatcgtgctggaaacggccttgccggccaagttcaacgaa
accatccgcgaagccctgggccgcgatgccgaccgtccggccggtttcgagaacatcgag
gcgctgccccagcgcttcgaagtgatgccggccgatgcggcgcgggtgaaggcctacgtg
gcgcagcacaccggcctgtaa

DBGET integrated database retrieval system