KEGG   Herbaspirillum seropedicae: Hsero_2168Help
Entry
Hsero_2168        CDS       T01268                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hse  Herbaspirillum seropedicae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hsero_2168 (galU)
   00052 Galactose metabolism
    Hsero_2168 (galU)
   00500 Starch and sucrose metabolism
    Hsero_2168 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Hsero_2168 (galU)
Enzymes [BR:hse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hsero_2168 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2438949..2439842
Genome map
AA seq 297 aa AA seqDB search
MMIKKIKKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIHYAVEEAVAAGITEMVFITG
RNKRAIEDHFDKAYELESELEAAGKKKLLEIVQNVVPKSVNCIFIRQSVPLGLGHAVLCA
RPVVGEEPFAVLLADDFMDTDAGVKPVLAQMTEIYEREGMSMLAVQEVPQSDTKQYGIVS
ATPYQPNLERVNAIVEKPAPEEAPSTLAVVGRYVLNNRIFDYLENIGRGAGGEIQLTDGI
AKLMQAESVLAYRYQGQRYDCGSKLGYLKATVAMGMKHPETGAAFSEFLKDVAGKQA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcaagaagatcaagaaagccgttttccccgtcgccggtctcggcagccgcttc
ctgccggccaccaaggcccagcccaaggaaatgctgcccatcgttgataagccgctgatc
cactacgcggtcgaagaagcggttgctgccggcatcaccgaaatggtgttcatcaccggt
cgcaacaagcgcgccatcgaagaccacttcgacaaggcctacgagctggaaagcgaactg
gaagcggcgggcaagaagaagctgctggaaatcgtccagaacgtggtgcccaagagcgtc
aactgcatcttcatccgccagtccgtgccgctgggcctgggccacgccgtgctgtgcgcg
cgtccggtggtaggtgaggagccctttgccgtgctgctggccgacgacttcatggatacc
gacgctggcgtcaagccggtgctggcgcagatgaccgagatctacgagcgcgaaggcatg
agcatgctggccgtgcaggaagtgccgcagagcgataccaagcaatacggcatcgtcagc
gccacgccttaccagcccaacctggagcgggtcaacgccatcgtcgagaagccggcgccg
gaagaggccccgtccacgctggccgtggtgggccgctatgtgctcaacaaccgcatcttc
gactacctggaaaacatcggtcgcggcgctggcggcgagatccagctcaccgacggtatc
gccaagctgatgcaggcggaatcggtgctggcctatcgctaccagggccagcgttatgac
tgtggttccaagctgggttatctgaaagccacggtcgccatgggcatgaagcaccccgag
accggcgcggccttcagcgagttcctcaaggatgtggccggcaagcaggcctga

DBGET integrated database retrieval system