KEGG   Herbaspirillum seropedicae: Hsero_2656Help
Entry
Hsero_2656        CDS       T01268                                 

Gene name
chlI
Definition
Mg-chelatase subunit ChlI protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hse00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3031002..3032993)
Genome map
AA seq 663 aa AA seqDB search
MTALPVYPFSAIVGQPLLQQALLLCAVDPGIGGVLVRGDKGTAKSTAARGLTQVLPPIAR
VAACAFNCAPGQPAAACTLCNGDNAPAAAPADLPFVTLPLGATEDRVLGSLDLQQALQGG
QRAFQPGLLAAAHRGILYIDEVNLLADHLVDVLLDVAAMGINAVQREGLSVSHPARFTLI
GTMNLEEGDLRPQLLDRFGLMVEVNAPTDKTVRAEVVRRRIAFEADPAAFASQWQDRQDA
LRNQVAQAQRLLPEVVLDDAMLELISHLCCEFEVASLRADIVMHKTARAIAALQARSRVT
PDDVREAALLVLPHRRRRKPFEQTGMDQDKLDDLIDQARTPEPPAPDAGEGSGEAPPQEP
SPEQEQPEEGEQDQQDQPSEAGGQQTFAIAAAGQARKISVAAPAQASAASGRRSAVADAS
RGSAVRAVPDANPDRLAIGATLRSAAVRSALSGEAEPGERLAVSRADLHRQVRSGRGANL
IVFVVDASGSMAAQRRMEAVKGAVLALLTDAYQRRDQLAVIAFRGEQAQLLLAPTRSADL
AEQGLRELPTGGRTPLPHALQLAAQVLQQASPEAPPLLVILSDGKANVSLPGSHGDAWAQ
TLEAADMLAAQAVPALVLDTESGYLRLGRAAQLAEALGAPCLTLEQLTGDALALTVRAQL
GAR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttgcccgtctatcccttctcggccatcgtcggccagccgctgctgcagcag
gcgctgctgctgtgcgccgtcgatcccggcatcggcggcgtgctggtgcgcggcgacaag
ggaaccgccaagagcaccgccgcacgcggcctgacccaggtgctgccgcccattgcccgg
gtagccgcgtgcgccttcaactgcgcccccggccagccagcggcggcttgcacgctctgc
aacggcgacaacgcgcccgccgccgcgccggcagacttgcctttcgtgaccctgccgctg
ggcgcgaccgaagaccgcgtgctgggttcgctcgatctgcagcaagccctgcagggcggc
cagcgcgccttccagccgggcctgctggcggcggcccatcgcggcatcctctatatcgat
gaagtcaacctgctggccgaccacctggtcgatgtgctgctggacgtggccgccatgggc
atcaatgcggtgcagcgcgaaggcctgtcggtgagccatccggcgcgcttcaccctgatc
ggcacgatgaacctggaggagggcgacctgcgcccgcaactgctggaccgcttcggcctg
atggtggaggtcaacgcacccaccgataagaccgtacgtgccgaggtggtgcgccggcgc
atcgccttcgaagccgatcccgccgccttcgccagccagtggcaagaccgccaggacgcc
ttgcgcaaccaagtggcccaggcccagcgcctgctgcccgaggtggtgctggacgatgcc
atgctggaactgatcagccatctctgctgcgagttcgaggtggccagcctgcgcgccgat
atcgtcatgcacaagaccgcccgcgccattgccgccttgcaggcgcgttcccgcgtgacc
ccggacgatgtgcgcgaggccgccttgctggtgctgccgcatcgccgccgccgcaagccc
ttcgagcagaccggcatggaccaggacaagctggacgacctgatcgatcaggcccgcact
cccgagccgccagcccctgatgcgggcgaaggaagtggagaggcgccaccgcaggaacca
tcccctgaacaagaacagccggaggagggcgagcaggaccagcaggaccagccaagcgaa
gcaggcggccagcagaccttcgccatcgccgccgccggccaggcccgcaagatcagcgtg
gccgcgcccgcccaggccagcgcggccagcggccggcgcagcgcggtcgccgacgccagc
cggggcagcgccgtgcgcgccgtgccggacgccaatccggaccgcctggccattggtgct
acactgcgcagcgccgccgtacgcagcgccctcagtggcgaggccgagcccggcgagcgg
cttgccgtcagccgcgctgacctgcaccgccaggtgcgcagcggacgcggcgccaacctg
atcgtcttcgtggtcgatgcctcgggatcgatggccgcccagcggcgcatggaagccgtc
aagggcgcggtgctggccctgctgaccgatgcctaccagcgccgcgaccagctggccgtg
atcgccttccgtggcgaacaggcgcaactgctgctggcgcccacccgcagcgccgacctg
gccgagcagggcctgcgcgagctgcccaccggcgggcgcacgcccttgccgcatgcgctg
caactggccgcgcaagtgctgcaacaggccagcccggaagcgccgccgctgctggtgatc
ctgtcggacggcaaggccaatgtcagcctgcccggcagccacggcgacgcctgggcgcag
accctggaagcggcggacatgctggccgcgcaggccgtgccggcgctggtgctcgatacc
gaatccggctatctgcgcctgggccgtgcggcccaactggccgaggcgctgggggcgcct
tgcctgaccctggaacaattgaccggcgacgccctggcgttgaccgtgcgcgcgcaactg
ggcgcgcgctga

DBGET integrated database retrieval system