KEGG   Herbaspirillum seropedicae: Hsero_2788Help
Entry
Hsero_2788        CDS       T01268                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
hse  Herbaspirillum seropedicae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3187457..3188368
Genome map
AA seq 303 aa AA seqDB search
MDTLSSTDHPGPVTPPPAEDRQGGPHKEHAVILLHGLCGSQLEMGSIPKQLKKAGCTVIP
LNIDNYSAALTNPRVSPNWEEWCAVVESRVARLKEEFRTVSLCGLSMGATLALAVAARSK
ELLSVVLLSPVLQYDGWSVPWYWKLLTVVYDLGFRNWSYKESEPYGIKNFEMRRRVASAL
EKDGVAAVGAASIPARHLRAALRMIDYVKQSLPLVRTDTLIIHSIDDETASPRNAEQILQ
YINAEVRKVVWLGDCYHIITVDNEREIVTNETVMFIRRSIEMHGHEFSRKHLAHASPLKD
RRG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggacactttgtcatccactgaccatccggggccagtcacaccgccccccgcagaagac
cgtcaaggcggcccgcacaaggaacatgccgtcatcctcttgcacggcttgtgcggctcg
caactggagatgggctcgattcccaagcagctcaagaaagccggctgtaccgtcattccc
ctcaatatcgacaattactcggcggcgctgaccaacccgcgtgtctccccgaactgggaa
gaatggtgcgccgtggtggaaagccgggtggcgcgcctgaaggaagaattccgcaccgtc
tccctgtgcgggctgtccatgggcgccaccctggccctggccgtggccgcccgcagcaag
gaactgctgtcggtggtgctgctctcgccggtgctgcaatacgacggctggtcggtgcct
tggtactggaagctgctgaccgtggtctacgacctgggctttcgcaattggtcctacaag
gaaagcgaaccctacggcatcaagaacttcgagatgcgccgccgcgtggccagcgccctg
gaaaaggatggcgtggccgccgtcggcgccgcctccatcccggcgcgccacctgcgcgca
gcgctgcgcatgatcgactacgtcaagcagtccctgccgctggtgcgcaccgataccctg
atcatccattccatcgacgacgagaccgcgtccccgcgcaatgccgaacagatcctgcag
tacatcaacgccgaagtgcgcaaggtggtctggctgggcgactgctatcacatcattacc
gtggacaacgaacgcgagatcgtgaccaatgagaccgtgatgttcatccggcgcagtatc
gagatgcatggtcacgaattctcacgcaagcacctggcgcatgcgtcacccctgaaggac
aggcgcggctga

DBGET integrated database retrieval system