KEGG   Herbaspirillum seropedicae: Hsero_2795Help
Entry
Hsero_2795        CDS       T01268                                 

Gene name
adhC2
Definition
zinc-type alcohol dehydrogenase transmembrane protein (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hse  Herbaspirillum seropedicae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Hsero_2795 (adhC2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hsero_2795 (adhC2)
  Lipid metabolism
   00071 Fatty acid degradation
    Hsero_2795 (adhC2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hsero_2795 (adhC2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hsero_2795 (adhC2)
   00626 Naphthalene degradation
    Hsero_2795 (adhC2)
Enzymes [BR:hse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hsero_2795 (adhC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3193168..3194292)
Genome map
AA seq 374 aa AA seqDB search
MKIQAAVLREMSDAHPFAVSQPLKIEELDLDPPGPGEVLVRMKAAGLCHSDLSVITGVRP
RPVPMALGHEASAEVVEVGSGVNDLRAGDLVVLVFVPSCGHCLPCMEGRPALCEPGAATN
TVGELLSGQRRLRDKTQPVHHHLGVSAFADHAVVSRRSCVKIEADIDPVQAALFGCAVLT
GVGAAVNTAEVKAGTTAAVLGLGGVGLCAMLGALASGAREVIAVDLHDSKLALARSLGAT
ATVNARDPDAVEKVRALTRGGVDYAFEMAGSVQAMEAAYRMTRRGGMTVTAGLPAPGQHW
ALQQVSLVAEERTVKGSYIGSCVPVRDIPRYIGLFQAGKLPVDRLMGERLALADINRGFD
RLHGGEGLRDLIVF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccaggccgccgtgttgcgcgaaatgagcgatgcgcatccattcgccgtgagc
cagccactgaagatcgaagagctcgatctggatccgcccggccccggcgaagtgctggtc
aggatgaaggcggccggcctgtgccattcggacctgtcggtcatcacgggagtgcgtccg
cgtccggtgccgatggccttgggccacgaggcctcggccgaggtggtggaggtggggagc
ggcgtcaatgatctacgggcgggcgatctggtggtgctggtgttcgtgcccagctgcggc
cattgcctgccttgcatggaaggcaggcccgccctgtgcgagccgggcgcggcgaccaat
acggtgggcgagctgctgtcggggcagcgccgtctgcgcgacaagacgcagccggtgcat
caccacctgggtgtgtcggcctttgccgatcacgccgtggtatcgcgccgttcctgcgtg
aagatcgaggccgatatcgacccggtccaggcggcgctgtttggctgcgccgtgctcact
ggcgtgggggcggcggtcaacacggccgaggtcaaggccggcaccacggctgccgtgctg
ggcctgggcggcgtgggcttgtgcgccatgctgggagcgctggcgtcgggcgcgcgcgag
gtcattgcggtggacctgcatgacagcaagctggcgctggcgcgttcgctgggggcgacg
gccaccgtcaatgcccgcgatccggatgcggtcgagaaggtccgggccctcaccaggggc
ggcgtggattacgccttcgagatggccggttcggtccaggccatggaagccgcctaccgc
atgacccggcgcggcggcatgaccgtcacggccggcctgccggcgcccggccagcactgg
gccttgcagcaggtcagcctggtggctgaggagcgtaccgtcaagggcagctacatcggc
tcctgtgtgccggtgcgcgacatcccgcgctacatcggcctgttccaggccggcaagctg
ccggtggacaggctcatgggcgagcgcctggcgctggccgatatcaatcgcggctttgac
cgcctgcatggcggcgagggcttgcgcgacctgatcgtcttttaa

DBGET integrated database retrieval system